(data stored in ACNUC29543 zone)

EMBL: CP001044.PE568

CP001044.PE568       Location/Qualifiers
FT   CDS_pept        653353..653973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3702"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A1492 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3702"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72837"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMP3"
FT                   /protein_id="ACC72837.1"
FT                   /translation="MKLNRTMLAALGLLAMSSAHATSFNCAIAHSTAETLICHDAGLSK
FT                   ADDELGKLFRLALKQTADRRAYRRDSDSKWTWREENCKDVACLTDWYSTRIGEIREHLR
FT                   KPAPGEEQARPVDSDLAAVSKPSAKRKAFESQAFARDVQQCTATTQDLVPPVQCSSVLE
FT                   KHAQWQTHGPATDGWFCGVAMIAPPPTDGGARKQAPNVLSESF"
     atgaagctca accgaaccat gctcgccgcg ctcggcctgc tcgcaatgtc gagtgcgcac        60
     gccaccagct tcaattgcgc tatcgcgcat tcgacggcag agacgctgat ctgccatgac       120
     gccggcctct ccaaagccga cgacgagctc ggcaagctgt tcaggctcgc actgaaacag       180
     accgccgacc gccgcgccta tcgacgcgac agcgacagca aatggacgtg gcgagaagag       240
     aactgcaagg acgtcgcgtg cctgacagac tggtactcga cgcgcatcgg ggaaatccgc       300
     gagcacctgc gcaaacccgc gccgggcgaa gagcaggcgc gccccgtcga tagcgatctc       360
     gcggctgtca gcaagccatc ggccaaacgc aaggcattcg aatcgcaagc gttcgcgcgg       420
     gacgtccagc agtgcacggc cacgacgcaa gacctcgtgc cgcccgtcca atgcagcagc       480
     gtcctcgaaa agcacgcgca atggcaaacg cacggtcctg ctacggatgg ctggttttgc       540
     ggcgtcgcga tgatcgcgcc gcctcccacg gacggcggcg cccgcaagca agcgccgaac       600
     gtgctttccg aatctttctg a                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page