(data stored in ACNUC29543 zone)

EMBL: CP001044.PE570

CP001044.PE570       Location/Qualifiers
FT   CDS_pept        654520..655074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3704"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sse:Ssed_3831 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3704"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72839"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMP5"
FT                   /protein_id="ACC72839.1"
FT                   /translation="MVSSVGYGMASTPSTHRASVSGEASAAVAQSAAGSAPRSEQNDAK
FT                   QDAASQAAQPGVTVSISPAGATAVSRMQRADSVVHKSNASANASAAADADLDADTDLDT
FT                   DVDTADIDGADGIEGGEPAGGTTASDDATPSDVSPVKAFAYGALGLERPDQPKDERNGF
FT                   YSAGKWLAAGLTIGGLISLLV"
     atggtaagca gtgtcggata tgggatggca tccacgccgt cgacgcatcg cgcttccgtg        60
     tccggcgaag catcggctgc agtcgcgcaa tccgcggcag gcagcgcacc tcgcagcgaa       120
     caaaacgatg cgaaacagga tgcggcgagc caggccgcgc agcccggcgt gacggtcagc       180
     atttcgcccg cgggcgcgac ggcggtgtct cgcatgcagc gagcggatag cgtggttcac       240
     aagagcaacg cgagcgcgaa cgcatcggcg gcggcagacg cggacctgga cgccgacacg       300
     gatctggata ccgatgtgga cacggcggac atagacggcg ccgacggcat cgagggcggc       360
     gagcccgccg gcggcacgac ggccagcgac gacgcaacgc cgtccgacgt gtcgcccgtg       420
     aaggcattcg cgtacggcgc acttggactc gagcggcccg atcagccgaa ggacgagcgc       480
     aacggcttct actcggcagg caaatggctc gccgccggac tgacgatcgg cggcctgatt       540
     tcgctgctcg tatga                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page