(data stored in ACNUC29543 zone)

EMBL: CP001044.PE573

CP001044.PE573       Location/Qualifiers
FT   CDS_pept        657303..658277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3707"
FT                   /product="transcriptional regulator, LysR family"
FT                   /EC_number="4.2.1.1"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: rpb:RPB_4389 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3707"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72842"
FT                   /db_xref="GOA:B2JMP8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMP8"
FT                   /protein_id="ACC72842.1"
FT                   /translation="MKTTGMTELEAVLAVARHRSFRAAANELGVSTSALSHAVAALEAR
FT                   IGVRLFNRTTRSVSLSEAGAQFVDSVAPALSSIRVALEQAGSFRDTPSGTLRINTSVGA
FT                   AHQAMPVFIAFLERYPEMKLDIVTEGRLIDIVVEGFDAGIRLAETVPQDMIAVPFGDRQ
FT                   RFAVVGSPAYFAQHTPPRTPHDLARHRCIRTRMPSGSIYQWEFERHGETVRIDGKGALT
FT                   LDESGLMLDAARAGVGLTYLSEWTVAADLEAGTLIRVLDDWTPPLDGLCLYYPGRRHAP
FT                   AGLRALVAMIRDWADTQRAEARVRRKRQPKTARADGAARRKKK"
     atgaaaacga cgggcatgac cgaactggaa gcggtgctgg cggtggcgcg ccatcgcagc        60
     ttccgcgccg cggccaacga gctgggcgtc tcgacgtcgg cgttgagcca cgccgtcgcg       120
     gcgctcgaag cacgcatcgg cgtgcgtctg ttcaaccgta cgacgcgcag cgtgtcgctc       180
     tcggaagcgg gcgcccaatt cgtcgacagc gtggcgcccg cgctatccag catccgcgtc       240
     gcgctcgaac aggcgggcag cttccgcgat acgccgagcg gcacgctgcg catcaatacg       300
     tcggtgggcg ccgcgcatca ggcgatgccc gtattcatcg cgttcctcga gcgctatccg       360
     gagatgaagc tcgacatcgt cacggaaggc aggctgatcg atatcgtcgt ggaaggattc       420
     gatgcgggca tccgcctcgc cgaaacagtg ccgcaggaca tgatcgccgt gccgttcggc       480
     gaccggcagc gcttcgctgt ggtcggaagc cccgcgtatt ttgcgcagca cacgccgccg       540
     cgcacgcctc acgatctcgc tcggcaccgc tgcatccgca cgcgcatgcc gagcggctcc       600
     atttatcaat gggagttcga gcggcatggc gaaacggtgc ggatagacgg caagggggcg       660
     ctgacgctag acgagtccgg cctgatgctc gacgccgcgc gcgccggtgt cggcctcacg       720
     tatctgagcg aatggaccgt cgccgccgat ctcgaagcgg gcacgctgat tcgtgtgctc       780
     gacgactgga cgccgcctct cgacggcctg tgcctctact atccggggcg ccggcacgcg       840
     ccggccggct tacgcgcgct ggtcgcgatg atccgcgatt gggcggacac gcagcgtgcc       900
     gaggcccgcg tcagacgcaa gcggcagccg aaaacggcac gcgcggacgg tgccgcgcgt       960
     cgcaagaaga aataa                                                        975
//

If you have problems or comments...

PBIL Back to PBIL home page