(data stored in ACNUC29543 zone)

EMBL: CP001044.PE574

CP001044.PE574       Location/Qualifiers
FT   CDS_pept        658384..658821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3708"
FT                   /product="DGPFAETKE family protein"
FT                   /note="PFAM: DGPFAETKE family protein; KEGG: reu:Reut_B3488
FT                   DGPFAETKE"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3708"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72843"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMP9"
FT                   /protein_id="ACC72843.1"
FT                   /translation="MRVMVIVKATTDSEADKMPSTELLAAMGQFNEELVKAGIMQAGEG
FT                   LHPSSRGKRVRFSGAKRTVIDGPFAETKELIAGFWLWKVKSMDEAVEWVRRCPNPMEGD
FT                   SEIEIRQIFEAEDFGDEFTPELREQEERLRAEIEQQAGKAK"
     atgcgagtca tggtgatcgt gaaggcgacg accgattccg aagcggacaa gatgcccagc        60
     accgaattgc tggccgcaat gggccagttc aacgaagaac tcgtgaaggc gggcatcatg       120
     caggcgggcg aaggcctgca tccgagttcg cgcggcaagc gggtgcgctt ttcgggcgcg       180
     aagcggacgg tgatcgacgg tccgtttgcg gagacgaagg aactgatcgc agggttctgg       240
     ctgtggaagg tgaagtcgat ggacgaggcc gtcgaatggg tgcggcgctg cccgaatcca       300
     atggaaggcg attcggaaat cgaaattcgt cagatattcg aggctgaaga tttcggcgat       360
     gagttcacgc ccgagttgcg cgaacaggaa gaacggctgc gtgcggagat cgagcagcag       420
     gcgggcaaag cgaagtaa                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page