(data stored in ACNUC29543 zone)

EMBL: CP001044.PE579

CP001044.PE579       Location/Qualifiers
FT   CDS_pept        663329..664186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3713"
FT                   /product="methyltransferase"
FT                   /note="TIGRFAM: methyltransferase; PFAM:
FT                   O-methyltransferase domain protein; KEGG: bte:BTH_II1091
FT                   transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3713"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72848"
FT                   /db_xref="GOA:B2JMQ4"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMQ4"
FT                   /protein_id="ACC72848.1"
FT                   /translation="MKNDQTVAPDSTAVRVALWRAMHVQVDAAPHVLDDEIGLRLAAPD
FT                   AGWRDRPDMDARGTRGYRASIVGRARFIEDLVAQQRDRGVEQYVILGAGLDTFAQRQPE
FT                   LASRLTVFEVDRPGAATWKRQRLVELGYGVPDWLRLVPVDFEAGQSWWEQIAHAGFDAD
FT                   APAVIASTGVSMYLTRDANLATLRQIAKLAPGSTLAMTFLLPLDLVDPAERAQHESVYE
FT                   RARAAGTPFVSFFTPDEMLALGHKAGFRRVEYVSTGDLVGRYFARRRDDLRPSTGEAFL
FT                   VATT"
     atgaagaacg atcagactgt tgcgccagac agcaccgcgg tccgcgttgc gttatggcgc        60
     gcgatgcacg tacaggtcga cgcggcgccc catgtactcg acgacgaaat cggcctgcgc       120
     ctcgcggcgc ccgatgcagg ctggcgcgac cgtcccgaca tggacgcccg aggcacgcgc       180
     ggctatcgcg cgtcgatcgt agggcgtgca cggtttatcg aggatctcgt cgcgcagcag       240
     cgcgatcgcg gcgtcgagca gtacgtgatt ctcggtgcgg ggctcgatac gtttgcgcag       300
     cgtcagccgg aactcgcgtc gcgtctgacc gttttcgaag tggaccggcc cggcgcggcg       360
     acgtggaagc gccagcgcct ggtcgagctc ggatacggtg tgcccgactg gctgcggctc       420
     gtgcccgtcg atttcgaagc gggccagtcg tggtgggaac agatcgcgca tgcgggcttc       480
     gacgccgacg cgcccgccgt gatcgcatcg acgggcgtgt cgatgtacct gacgcgcgac       540
     gcgaatctgg ctacgttgcg tcagatcgca aagctggcgc ccggttcgac gttggcgatg       600
     actttcctgc tgccgctcga tctcgtcgat cccgcggaac gcgcgcagca cgagtccgtc       660
     tacgagcggg cgcgtgcagc gggcacgccg ttcgtcagct tcttcacgcc cgacgagatg       720
     ctggcgctcg ggcacaaagc gggcttcaga cgcgtcgagt acgtctcgac gggcgacctc       780
     gtcggacgct atttcgcccg ccgacgggat gacctgcggc cgtcgacggg tgaagcgttt       840
     ctcgttgcga cgacctga                                                     858
//

If you have problems or comments...

PBIL Back to PBIL home page