(data stored in ACNUC29543 zone)

EMBL: CP001044.PE581

CP001044.PE581       Location/Qualifiers
FT   CDS_pept        666098..666379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3715"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3715"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72850"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMQ6"
FT                   /protein_id="ACC72850.1"
FT                   /translation="MTNEPRPVRRLQLLLRDTCSNDAAREAARRAAGQLGMQISGEGRA
FT                   TLSARMSDAAFRRLFPHSSSMSGTLAVPDSLEPYVASISEAPQHLSFD"
     atgacgaacg aaccccgtcc tgtgcggcgc ctgcagcttc tgctgcgcga cacatgcagc        60
     aacgacgcgg cacgcgaagc ggccagacgc gccgccgggc aactgggcat gcaaatcagc       120
     ggcgaaggcc gcgccacgct gtccgcacgt atgtccgatg ccgcattccg ccggcttttt       180
     ccccattctt ccagcatgag cggaaccctt gccgtgccgg acagtcttga accctacgtc       240
     gcatcgatca gcgaagcgcc gcagcatctt tcattcgatt aa                          282
//

If you have problems or comments...

PBIL Back to PBIL home page