(data stored in ACNUC29543 zone)

EMBL: CP001044.PE584

CP001044.PE584       Location/Qualifiers
FT   CDS_pept        669576..670040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3718"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dar:Daro_1991 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3718"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72853"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMQ9"
FT                   /protein_id="ACC72853.1"
FT                   /translation="MRKQAVHYALVFACGCAVAIGARAADAIGVVKTVKGAVHIERAAQ
FT                   SVDALIGSEVYGSDRIVTGPASSVGITLRDNTLLSEGSSSVLELNHFAFNTTTHDGALD
FT                   ATIRRGSLAVVDGKLAKAHPEAVRFSTPTTTLGVRGTEFIIEVGDGENTR"
     atgcgcaagc aagccgttca ctatgcactg gttttcgcct gcggatgcgc ggttgccatc        60
     ggcgcacgcg ccgcggatgc aatcggcgtc gtcaagacgg tgaagggcgc tgtccatatc       120
     gagcgggccg cacaaagcgt cgacgcgctg atcggcagcg aggtctacgg gagcgaccgg       180
     atcgtgacgg gccccgcctc ttcagtcggc attacgttac gcgacaacac gctgctttcc       240
     gagggttcga gttccgtgct cgaactgaac cacttcgcgt tcaacacgac gacacacgac       300
     ggtgcgctgg acgccaccat ccggcgcggc tcgcttgccg tcgtcgacgg caagctggcg       360
     aaagcgcatc ccgaagcggt ccgcttcagc acgcccacca cgacgctggg cgtacgcggc       420
     accgagttca tcatcgaggt cggcgacggg gagaacacgc gttga                       465
//

If you have problems or comments...

PBIL Back to PBIL home page