(data stored in ACNUC29543 zone)

EMBL: CP001044.PE586

CP001044.PE586       Location/Qualifiers
FT   CDS_pept        670713..672212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3720"
FT                   /product="putative Chase2 sensor protein"
FT                   /note="PFAM: CHASE2 domain protein; KEGG: dar:Daro_1993
FT                   CHASE2:stage II sporulation E"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3720"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72855"
FT                   /db_xref="GOA:B2JMR1"
FT                   /db_xref="InterPro:IPR007890"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMR1"
FT                   /protein_id="ACC72855.1"
FT                   /translation="MKRLSAPWVTFFRKLLKAGQGRPVALAVLFGLSLLNLYSEWPGGI
FT                   ARPAVFDRFEDFIPDSFNSARQLLFDHYQRRFPRVPASQPVIIVAIDDKTLAAVGQWPW
FT                   PRNRLASLVDAIAAQKPLAIGLDVYMPEADQTSPDKVADNLPDSAATLAAGLRALPSHE
FT                   TILAAALRAAPSVLGAAAVDHAALDTSTDLHSAPILVHGVDPLNHVKRYGYVLASLPEL
FT                   QAAAHGQGMLNVALEQGAVRRIPLILGLGDKLVPCMPIEMLRVVTRSAAVDVYADAAGV
FT                   QSVGVADVQVPTQPDGDIWLHFASMRSTQHRYVSAGDVLQGQVDPERFRDKLVLVGLTG
FT                   TGLTDMRTTALGELVPGIEIQAQIIETIFEGRFLRRPVWVKWVETLFVLGFGLLIIWYL
FT                   PHTDSKLAAFVRAVPKGTAIIGVVLNLLLLATCLLLFKLFGLLVDAASIFIILSAVMGC
FT                   FFSTALLDSAQTLRDALLSRPTKANAPEKTAAAQPVRHPES"
     atgaaacgct tgagcgcccc atgggtgacg tttttccgca agctgctgaa agcggggcaa        60
     ggccgccccg tcgcgcttgc ggtgctgttc ggactgagcc tgctcaacct gtatagcgag       120
     tggcccggcg gcattgcgcg cccggccgta ttcgacagat tcgaggattt catcccggac       180
     tcgttcaact cggcgcggca gttgctgttc gatcactatc agcggcgctt tccgcgcgtg       240
     ccggcctccc agcccgtgat catcgtggcg atcgacgaca agacccttgc cgctgtcggt       300
     cagtggccgt ggccgcgcaa ccggctggcc agtctcgtcg atgcaatcgc cgcccagaag       360
     ccgcttgcaa tcggcctcga cgtctacatg cccgaagcgg accagacctc gcccgacaag       420
     gtggccgaca acctgcccga ttcggctgcc acgctcgctg ccggtttgcg tgcgctgccg       480
     agccacgaga cgattctcgc ggccgccttg cgcgccgcgc catccgtgct cggcgctgcc       540
     gccgtcgatc acgccgcgct cgataccagc accgatctgc acagcgcgcc gattctcgtg       600
     catggtgtcg atccgttaaa ccatgtgaag cgatatggct acgtgctcgc gagcctgccg       660
     gaattacagg cggcggcgca cggccagggg atgctgaatg tcgcgctcga acaaggcgcg       720
     gtgcggcgca tcccgctgat tctggggctc ggcgacaagc tggtgccgtg catgccgatc       780
     gaaatgctgc gtgtcgtcac gcgctcggcg gccgtcgatg tctatgcgga cgcggcgggc       840
     gtgcagtcgg tcggcgtcgc agatgtacag gtgcccacgc agcccgacgg cgacatctgg       900
     ctacatttcg cgtccatgcg ttcgacgcag catcgctatg tgtcggcggg cgacgtcctg       960
     caaggacaag tcgatcccga gcgctttcgc gacaagctcg tactggtcgg actaacgggc      1020
     acgggtctca ccgatatgcg cacgaccgcg ttgggcgaac tggtgccggg catcgaaatc      1080
     caggctcaga tcatcgagac gattttcgag gggcgtttcc tgcggcgtcc cgtctgggtc      1140
     aaatgggtcg agacgctgtt cgtgctcggc ttcggtctgc tgatcatctg gtatctgccg      1200
     cacaccgatt cgaaactggc ggcgttcgtg cgcgccgtgc cgaagggaac ggccatcatc      1260
     ggtgtggtgc tgaatctgct gttgctcgcg acttgcctgc tattgttcaa gctctttggc      1320
     ctgctggtcg atgcggcgtc gatcttcatc atcctgtctg ccgtgatggg ctgcttcttc      1380
     tctaccgcgt tgctcgacag tgcgcaaacc ttgcgcgacg cgctgctctc gcgtcccacc      1440
     aaagccaacg cgccggaaaa gacggcggcc gcgcaacccg tccgccatcc cgagtcatga      1500
//

If you have problems or comments...

PBIL Back to PBIL home page