(data stored in ACNUC29543 zone)

EMBL: CP001044.PE59

CP001044.PE59        Location/Qualifiers
FT   CDS_pept        complement(68114..69004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3160"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein DeoR; Helix-turn-helix type
FT                   11 domain protein; KEGG: bxe:Bxe_B1665 transcriptional
FT                   regulator, DeoR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3160"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72328"
FT                   /db_xref="GOA:B2JRK1"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRK1"
FT                   /protein_id="ACC72328.1"
FT                   /translation="MGPTRPCGFIWTYIESAQLGLLDWRSFPDPAPMFATHRQNEILRL
FT                   VRARQTCTIAELAATFAVSDETIRRDLKPLVAGGLLVKVHGGVMLPAQLDEPPFRRRMV
FT                   EQREAKRAIAARVAQLIEDGDSLMLDGGTTCVHIAQALESHTRLSVVTNSAEVARLLSP
FT                   RNGNRVLMAGGELRADDASAVGDSALAFFRQFHVRHAIVSVTAIDAKARFMDAHPADAA
FT                   IAQAAFAQAERRIVAADHTKFGHSALVHVFGAQGLDTLVTDIEPATGLSKVLTHAGVEI
FT                   IRASSVADDTSEEVV"
     atgggcccaa ccaggccgtg tggatttatt tggacttata ttgaatctgc ccaactcggt        60
     ttgctagact ggcgctcatt tcccgatccc gcccccatgt tcgccacgca tcgacagaac       120
     gaaattttgc ggctcgtccg agcacgccag acgtgtacga tcgcggagct ggcagcgacc       180
     tttgcggtgt ccgacgagac catccgccgc gatctcaagc cgctcgtcgc gggcgggctg       240
     ctggtgaaag tgcacggcgg cgtcatgctg cccgcgcaac ttgacgagcc gccgttccgg       300
     cgtcgcatgg tcgaacagcg cgaggcgaaa cgcgcaatcg ccgcacgcgt cgcgcaactg       360
     atcgaggacg gcgattcgct gatgcttgac ggcggcacga cctgcgtgca tatcgcgcag       420
     gcgctcgaat cgcacacgcg cctctcggtc gtgaccaatt cggccgaagt cgcgcgcctg       480
     ctctcaccgc gcaacggcaa ccgcgtgctg atggcgggcg gcgaattacg cgcggacgac       540
     gcatccgccg tcggcgacag tgcgctcgcc ttcttccggc aatttcatgt gcgccacgcg       600
     atcgtgtcgg tgacggccat cgacgcgaaa gcgcgcttca tggacgccca tcccgccgat       660
     gccgcgattg cacaagcggc gtttgcgcaa gccgaacgcc gcatcgtcgc cgccgaccac       720
     accaaattcg gtcatagcgc gctggtgcat gtgttcggcg cgcaagggct ggacacgctg       780
     gtcacggata tcgagccggc cacgggtctg tcgaaagttc taacgcacgc cggggtcgag       840
     ataatccgtg cgtcgtccgt tgccgacgat acaagtgaag aagtcgtcta a                891
//

If you have problems or comments...

PBIL Back to PBIL home page