(data stored in ACNUC29543 zone)

EMBL: CP001044.PE592

CP001044.PE592       Location/Qualifiers
FT   CDS_pept        678448..679764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3726"
FT                   /product="O-antigen polymerase"
FT                   /note="PFAM: O-antigen polymerase; KEGG: bam:Bamb_6488
FT                   O-antigen polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3726"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72861"
FT                   /db_xref="GOA:B2JMR7"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMR7"
FT                   /protein_id="ACC72861.1"
FT                   /translation="MAYISVLALFLTVTNLIPVSAVGFLPIAFCAWRFFGRSYPSFMGP
FT                   LTALTLFIVVSTLLYDPRSLTEFEFYRRDGNFFISYAPIFAGCVYSHRWDMNKMLRAFF
FT                   VFAVLINIPPYMLYLAQNGLLAIFKNPGDSFGSFFIARNAAGGFLAMMFCLGVACYLQR
FT                   RSKIMLLLIGLNGLMLFSTYSRGSLLGALAILPYLYFGRKRLILASLMSCLVVASLAMA
FT                   FYHLRGNVDYMGYPFSIQNADAKVANLDIRYEWLWPRALTYFRQSPIVGMGFGSFDDTI
FT                   RHVASYFGVFSVPSDIVIEHSDSHAHNSYLNFLAELGVVGLALVLSFFWKLITWSQNGA
FT                   ARAALVEHGQNFTAYRFIELSCVCLLVMAATEHRLVAPSNVLILSLVISLLLASRPVRV
FT                   ARPANNPQVVRPKPPYREHVPPAPPRYPAGATGRIAPGS"
     atggcttata tatcggtatt ggcgctattc ctgacggtca caaatctgat acctgtgagc        60
     gcagtgggat ttttgccgat cgcattttgc gcatggcgct ttttcggaag aagctacccg       120
     tcgtttatgg gtcccctcac ggcactcacg ctattcatag tcgtgtcgac gctgctttac       180
     gacccgcgtt cgctgaccga attcgagttc tatcggcgcg acggcaactt cttcatttcc       240
     tatgcaccga tattcgcggg ctgcgtgtat tcgcaccgct gggatatgaa caaaatgctg       300
     cgcgcgttct tcgtgttcgc ggtgctgatc aatatcccgc cgtacatgct gtatctcgcg       360
     cagaacggct tgctcgccat cttcaagaat cccggcgaca gcttcggcag ctttttcatt       420
     gcacgtaacg ctgcgggcgg cttcctcgcg atgatgttct gcctcggcgt cgcgtgctat       480
     ctccagcggc gcagcaagat catgctcctg ctgatcggcc tcaatggact gatgctcttc       540
     tccacctaca gccgcggctc gctgctgggt gcgcttgcca tccttccgta tctgtatttc       600
     ggccgcaagc ggctgattct cgcatcgctg atgtcgtgcc tcgtggtcgc atccctcgcg       660
     atggcgttct atcacctgcg gggcaacgtc gactacatgg gctacccgtt ctcgatccag       720
     aacgcggacg ccaaggtcgc gaatctcgac atccgctacg aatggctgtg gccgcgagcg       780
     ctgacgtact tccgccagag cccgatcgtc ggcatgggct tcggctcgtt cgacgatacg       840
     atccgccacg tcgcctctta ctttggcgtg ttctccgtgc catcggatat cgtcatcgag       900
     catagcgact cacacgcgca caactcttat ctgaacttcc tcgcagagct gggcgtggtc       960
     ggactcgcgc tggtgctgag ctttttctgg aagctcatca cgtggagtca gaatggcgcc      1020
     gcacgcgccg cgctggtcga gcatgggcag aacttcacgg cataccgttt catcgaactc      1080
     tcttgcgtgt gcctcctcgt gatggcggcg acggaacacc ggctcgttgc gccgtcgaac      1140
     gtgctgattc tctctctcgt gatttcgcta ctgcttgctt cgcgtcctgt gcgcgtggcg      1200
     agaccagcaa acaacccgca ggtggtacgt ccgaagccgc cctatcgaga gcacgtacca      1260
     cccgcaccac cgcgttatcc cgccggtgcg accgggcgta tcgcacccgg ctcataa         1317
//

If you have problems or comments...

PBIL Back to PBIL home page