(data stored in ACNUC29543 zone)

EMBL: CP001044.PE595

CP001044.PE595       Location/Qualifiers
FT   CDS_pept        complement(681694..683010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3729"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; KEGG:
FT                   dra:DR_A0035 O-antigen transporter RfbX, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3729"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72864"
FT                   /db_xref="GOA:B2JMS0"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMS0"
FT                   /protein_id="ACC72864.1"
FT                   /translation="MDRKKSASVIAFVYGGYLMRYVYLIIVVPFYGRVLGVAEYGRVLA
FT                   AMSLMNVIWMLASYGFTFVGMREISKAQNNSEYNAIFSLHTSARLTLCALGGLIGIIAT
FT                   YCSPILSERPLIGFLATALGVVSALNLGWLYQGRHHFRTPIMIEVFGFAVSLALVLVLV
FT                   RGPADSVWVVASLLTAGVLSLCISYGLAIYQIGRPHLSFAGITDLVKGSTMLFCYSSGS
FT                   VVLTASATYLLTLLSTPAQVGYFGAAERFATIGLSLMGPASQVFIPTISRQLAQGDKAG
FT                   AHVTTRRGATLLLGYGLLVFCGALALSPFVLPLILGEAFTPSAHVLQCFAWMFPFAAFN
FT                   EFAAFYVFVPRKKDRLLAIAGAASGVTNLLAALWLAPRYGAEGMAFARVIGELSLSMML
FT                   LTIMIRLELITLVPGAGRAIAMARVAWGARGGAGAGKDD"
     atggatcgta agaagagcgc tagcgtcata gcattcgtct acggcggcta tctgatgagg        60
     tatgtgtacc ttatcatcgt cgtgccgttc tacggacgcg tgctgggcgt cgccgaatac       120
     gggcgcgtgc tcgcggcgat gtcgctcatg aacgtcatct ggatgctggc gagctacgga       180
     ttcacattcg tcggcatgcg cgaaatttcc aaggcgcaga acaatagcga atacaacgct       240
     attttctcgt tgcacaccag cgcgcgcctg acgctatgcg cgctgggcgg gctcatcggc       300
     atcatcgcga cgtattgctc gcccatactg tcggagcggc ctctcatcgg ctttctggcg       360
     acggcgctag gcgtcgtgtc ggctttgaat ctaggctggc tgtatcaggg acgtcaccat       420
     ttccgcacgc cgatcatgat cgaggtattc ggctttgcgg tgagcctcgc gctcgtgctg       480
     gtcctggtca gaggaccggc ggactcggtc tgggtcgtcg cgagcctgtt gacggcaggt       540
     gtgttgtctc tctgcatttc gtatgggctg gccatctatc agatcgggcg accgcatctt       600
     tctttcgcgg gcatcacgga tctggtgaaa ggctcgacga tgctcttctg ctattcgtcg       660
     ggctccgtcg tgctcacggc atcggcaacg tatctgttga cgctgctctc gacgcccgcc       720
     caggtgggct atttcggtgc cgccgagcgc tttgcgacga tcggcttgag tctgatggga       780
     cctgcatcgc aggtgttcat cccgacgatc tcccgtcagc tggcccaagg ggacaaggcg       840
     ggcgcgcatg tcacgacgcg gcgcggtgcg acgctgctgc tgggctatgg actgctggtc       900
     ttctgcggtg cgttggccct gtcgccattt gtgctgccgt tgattctcgg cgaagcgttt       960
     acgccgagtg ctcatgtgtt gcagtgcttt gcatggatgt tcccgtttgc ggccttcaat      1020
     gaattcgcgg cgttctatgt gttcgtgccg cgcaagaagg atcgcctgct cgctattgcg      1080
     ggcgccgcgt ccggcgtcac gaatctgctg gcggcgttgt ggttggcgcc gcgatacggc      1140
     gctgaaggca tggcgttcgc tcgtgtgata ggcgagctgt cgctgtcgat gatgttgctg      1200
     accatcatga tccggctcga actgatcacg ctggtgcccg gcgccgggcg tgccattgct      1260
     atggcgcgtg tggcgtgggg cgcgagaggc ggggcgggtg ccggcaagga tgattga         1317
//

If you have problems or comments...

PBIL Back to PBIL home page