(data stored in ACNUC29543 zone)

EMBL: CP001044.PE598

CP001044.PE598       Location/Qualifiers
FT   CDS_pept        complement(685623..686738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3732"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   bxe:Bxe_A3712 putative glycosyl transferases group 1
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3732"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72867"
FT                   /db_xref="GOA:B2JN19"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:B2JN19"
FT                   /protein_id="ACC72867.1"
FT                   /translation="MAFAINGKFTSQPITGVQRVAYELTRAMQMRESPGSELEIFVPQN
FT                   AREPGASLKRQRRFPWLRGTLWEQITLPIAARGRTLVNLCNTNPVLKRRQVVMVHDMAV
FT                   YDMPHGFSKKFLLWYRLCFSILPRMEPLVLTVSAFSKRRISHHLKIDESRIAVIQPGAD
FT                   HLDRVVPESGVLERLQLKEDTYCVIVGSLDPRKNLQRVLEAISGLSHLRDVKFVIVGGR
FT                   NQRIFANEGLETMSRSKQVIWAGFVSDGELKALYQHAGCLVFPSLYEGFGLPPLEAMYC
FT                   GCPVIASSRTSIPEACGDAAMYCDAMSVADMAEKISLMMTHSAIRQQYRAKGMAHAREY
FT                   RWDRSAKRLLDLLYGKESEPVSEMSARVSAG"
     atggcattcg cgatcaacgg caaattcaca tcgcagccga taacaggcgt tcagcgagtc        60
     gcatatgagc tcacgcgagc catgcagatg cgcgaatccc cgggcagtga actggaaatc       120
     ttcgtgccgc aaaacgcgag agaacccggc gcgtcgctga agcggcagcg gcgttttccg       180
     tggctgcgcg gcacgctgtg ggagcagatc acgctgccga tcgcggccag agggcgcacg       240
     ctcgtcaatt tgtgcaacac gaatcccgtt ctcaagcgcc ggcaggtggt gatggttcac       300
     gacatggccg tgtatgacat gccgcatgga ttctcgaaga agtttctgct gtggtaccgg       360
     ctgtgcttct cgatcttgcc ccgcatggag ccgctggtgt tgacggtgtc cgccttttcg       420
     aagcggcgca tcagtcatca cctgaagatc gacgaatcgc gaattgccgt tatccagcca       480
     ggagcggacc atctcgatcg cgtcgtgccg gaatccggcg tgctggaaag gctgcaattg       540
     aaggaagaca cgtactgcgt gatcgtcgga agtctcgatc cgcgcaagaa tctgcagcgt       600
     gttctcgaag cgatctccgg cctgagtcat ttgcgcgacg tcaaattcgt gatcgtcggt       660
     ggaaggaatc agcgaatctt cgcgaatgaa ggactcgaga cgatgtcccg ctccaagcag       720
     gtcatctggg ccggcttcgt gtccgacggc gagttgaagg cgctctatca gcatgcggga       780
     tgcctcgtgt ttccgtcgct gtatgaaggc tttgggctgc cgccgctcga agcgatgtat       840
     tgcggctgtc ccgtgatcgc ttcatcgcgc acgtcgatac ccgaagcgtg cggcgatgcc       900
     gcgatgtact gcgatgcgat gtcggtcgcg gacatggccg agaagatctc gctgatgatg       960
     acgcacagcg cgatccggca gcaataccgc gcgaaaggca tggcgcatgc gcgggaatat      1020
     cgctgggacc gttcggcgaa gaggctgctc gatttgctgt atggcaaaga gagcgaacct      1080
     gtatcggaga tgtccgcgcg tgtgtcggcg ggctga                                1116
//

If you have problems or comments...

PBIL Back to PBIL home page