(data stored in ACNUC29543 zone)

EMBL: CP001044.PE6

CP001044.PE6         Location/Qualifiers
FT   CDS_pept        3747..3965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3107"
FT                   /product="regulatory protein, FmdB family"
FT                   /note="TIGRFAM: regulatory protein, FmdB family; PFAM:
FT                   Putative regulatory protein FmdB; KEGG: bch:Bcen2424_6619
FT                   putative regulatory protein, FmdB family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3107"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72275"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:B2JR49"
FT                   /protein_id="ACC72275.1"
FT                   /translation="MPVYDYTCADCGAFEAVRRIAERDEPAACPRCGTLAQRVRIGAPA
FT                   LLGGASGDASGGEGGYGMRHRGCSCCP"
     atgcctgtgt acgactacac ctgcgccgac tgcggcgcgt ttgaagcagt gcggcggatc        60
     gcggaacgcg acgagcccgc ggcctgcccc cgctgcggca cgctcgcgca acgcgtgcgg       120
     atcggcgcgc ccgcattgct gggcggcgcg tcgggcgacg cctccggcgg cgaaggcggc       180
     tatgggatgc ggcatcgcgg ctgctcctgc tgtccgtga                              219
//

If you have problems or comments...

PBIL Back to PBIL home page