(data stored in ACNUC29543 zone)

EMBL: CP001044.PE600

CP001044.PE600       Location/Qualifiers
FT   CDS_pept        690084..691121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3734"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: reh:H16_A1853 transcriptional regulator,
FT                   AraC-family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3734"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72869"
FT                   /db_xref="GOA:B2JN21"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B2JN21"
FT                   /protein_id="ACC72869.1"
FT                   /translation="MNGIYQSHPLRADERPENSKLRKHIGLLIAPHCSMAAAGAISDAF
FT                   CLANKLEEELGVDAPYRFTVLSEGGGFVTGGASFPIWTQKLDRYQLSDFHAFFVACSGD
FT                   PTTESSEQLVAWLSRQGPGAPACTRQKTDLSSGSVQSAVPVFVLDDGLSATRPAGATPT
FT                   EMALVQIERDVSPDTVRRIAHSLQPHVRQRMRPDADDLSSATTTEKIRESARWIRENYS
FT                   KTISVSQAADSAAMSKRNYQRRFKVEFGMTPLEYLLRTRFEVVCSMLMDTDLPIDKIAR
FT                   RCGMGDGNRLGRIFKVRYGMSPTSFRALRHLGNANHGAPVPPAAANCRALQPTAAASSL
FT                   MKSAY"
     gtgaatggga tttatcaatc gcacccgttg cgtgccgatg aacggcccga aaactcgaag        60
     ttgagaaagc acattggtct cctcatcgct ccgcattgct ccatggcagc tgcgggcgcg       120
     attagcgatg ctttttgcct ggctaacaag ctcgaagagg agcttggcgt ggacgcgccc       180
     tatcgcttta ccgtgctgtc cgagggggga ggattcgtaa cgggcggcgc cagctttccg       240
     atctggacgc agaagcttga ccgctatcag ctctcggact ttcatgcgtt cttcgtcgcg       300
     tgcagcggcg acccgacgac ggagtcgagc gagcaacttg tcgcgtggct gtcgcgccag       360
     gggccaggcg cgcccgcctg cacacggcaa aagaccgacc tttcaagcgg ttcggtgcag       420
     tccgctgtgc ccgttttcgt gctcgacgat gggctctcgg caacgcgccc ggcaggcgcg       480
     acgccgacgg agatggcgct cgtgcaaata gaacgcgatg tcagcccgga taccgtgcgt       540
     cgcattgcac attcattgca accgcacgta cgccagcgca tgcggccaga tgccgacgac       600
     ctgagcagtg cgaccacgac tgagaaaatc cgcgaatccg cgcgctggat acgggagaac       660
     tatagcaaga ccatctccgt gagccaggcc gcagactcgg cggcaatgag caagcgcaac       720
     tatcagcgcc ggttcaaggt ggaatttggc atgaccccac ttgagtactt gctgcgcacg       780
     cgcttcgagg tcgtgtgctc gatgttgatg gacaccgatc tgcccatcga caagattgcg       840
     cggcggtgcg gcatgggcga tggcaatcgg ctggggcgga tcttcaaggt tcgttatggc       900
     atgtccccga cgagcttccg cgcactgcgc catctcggca acgctaatca tggtgctccc       960
     gtaccacccg cagcggcgaa ttgccgtgct ctgcaaccca ccgcagcggc aagttcgctg      1020
     atgaagtctg cttactag                                                    1038
//

If you have problems or comments...

PBIL Back to PBIL home page