(data stored in ACNUC29543 zone)

EMBL: CP001044.PE602

CP001044.PE602       Location/Qualifiers
FT   CDS_pept        complement(692231..693781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3736"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A3851 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3736"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72871"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B2JN23"
FT                   /protein_id="ACC72871.1"
FT                   /translation="MNKRRQFLGALTALGGSYILTACGGGGTDISAGAGDAVAKATARA
FT                   STSASGTTIPSATSIIDNAGNTWTLSGGSVYKNGAKAGNTYNVSLVLFMGGVIYHQGSG
FT                   GQFYAWNGSAWNACNDPRLGGTSPDGTTIPSASYIIDKTGAMWTVVGGVIYRNNKTVGN
FT                   TYNVSMLLWYGGKIWHKGTGGQFYVNTDVGGWLPCSDPRIATAATAGMFYGINGHFDYT
FT                   YTPAQLVSILNGMGCKSYRVGCTDDPKQIAAVTKLAQAFQPAGITLLVLINQGVYDSNG
FT                   VVFSSESAAYNRGQQVAMTVANALKPYGVTIYECGNELTRQNATVLDFTNAGTKAVDFN
FT                   NANWPAMRGAMRGMIDGVKAVQPSAKCGINFCVADIGAADALWDGMQPDGSGGHPKVRW
FT                   DITTWHNYEVYGDIFNIGIDGAGPGFDLPTYCKARYGVPFIITEWNTGPEKTQTYRASY
FT                   ITSTLGKYYQARKSHNIQAVMYYVLDSGNNTYGVMTNGTALNPPYSAFTSFVSGNADI"
     atgaacaaac gacgtcaatt tctcggtgcc ctcacggctc tcggtggtag ctacatcctc        60
     accgcatgcg gcggcggcgg cacagatatc agcgcgggtg cgggcgatgc cgttgcgaag       120
     gcaacggccc gcgcatcgac ctccgccagc ggcacgacga ttccgtccgc tacgtcgatc       180
     atcgacaatg caggcaacac gtggaccctg tcgggcggat cggtctacaa gaatggcgcg       240
     aaagcaggca acacctacaa cgtatcgctc gtgctgttca tgggcggcgt gatctatcac       300
     caggggtcgg gaggtcagtt ctatgcgtgg aacggctcgg cctggaacgc ctgtaacgac       360
     ccgcgtcttg ggggaacctc gcccgacggg acgacgattc cgtccgcctc gtacatcatc       420
     gacaagacgg gcgcgatgtg gactgtggtc ggcggtgtca tttaccgcaa caacaagacg       480
     gtgggcaata cgtacaacgt gtcgatgctg ctttggtacg gcggcaagat ctggcacaag       540
     ggcacgggcg gccagttcta tgtgaacacc gacgtgggcg gctggctgcc atgcagcgac       600
     ccgcgtattg ccacggcggc tacggcgggg atgttctacg gcatcaatgg ccacttcgac       660
     tacacgtaca cgccggcgca actcgtgtcg atcctcaacg gcatgggttg caagagctat       720
     cgcgtgggct gcacggacga tccgaagcag atcgccgcag tgaccaagct ggcgcaggca       780
     ttccagccgg caggcattac cctgctcgtg ctgatcaacc agggcgtgta cgactctaac       840
     ggtgttgtct tcagcagcga atctgctgca tacaaccgcg gccagcaggt cgccatgacg       900
     gtcgccaacg ccctcaagcc gtacggcgtg acgatctacg agtgcggcaa cgaattgacg       960
     cgtcagaacg caacggtgct cgacttcacc aacgcgggaa ccaaggccgt cgacttcaac      1020
     aacgcgaact ggcccgcgat gcgcggcgcg atgcgcggca tgatcgacgg cgtcaaggcg      1080
     gttcaaccgt cggcgaagtg cggcatcaac ttctgcgtcg ccgatatcgg cgctgcggat      1140
     gctctgtggg acggcatgca gccagacggt tcgggcggtc atccgaaggt gcgttgggac      1200
     atcacgacgt ggcacaacta cgaggtgtac ggcgatatct tcaacatcgg tatcgacggt      1260
     gcgggcccgg gcttcgatct gccgacgtac tgcaaggccc gctatggcgt tccgttcatc      1320
     atcaccgaat ggaacacggg gccggagaag acccagacgt atcgtgcaag ctacatcacg      1380
     agcacgctcg gcaagtacta tcaggcgcgc aaatcgcaca atatccaggc agtgatgtat      1440
     tacgtgctcg acagcggcaa caacacgtac ggcgtgatga ccaatggcac tgcgctcaat      1500
     ccgccgtata gcgcgttcac cagcttcgtt tccggtaacg ccgacatcta a               1551
//

If you have problems or comments...

PBIL Back to PBIL home page