(data stored in ACNUC29543 zone)

EMBL: CP001044.PE603

CP001044.PE603       Location/Qualifiers
FT   CDS_pept        complement(694616..695662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3737"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: bxe:Bxe_A3868 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3737"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72872"
FT                   /db_xref="GOA:B2JN24"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B2JN24"
FT                   /protein_id="ACC72872.1"
FT                   /translation="MFVENNLQWIPHKHFSATSTTQRIAFILTDACDLLGIGAIAEALE
FT                   CACSLESSAAARKYEMQFLSERGGHIQCDRSMFVSTEELPDSSETRFARVFIAGGAQAR
FT                   EACDAPRVAAWLQRVRAQGAPVRFLAAGVETSDLGAAMGSDGIGGVASGYELARRRRAQ
FT                   LGSAVKAAFEVIRADFGESIAHEALRRIAFVDSTEWLSPSVDATNTAADRIRAAARWLQ
FT                   DNCHRSVSIADAAEACAMSQRTLLRNFQAHMGASPSEYLQRVRLERACQLLAETSLPAD
FT                   KVARRVGLTNGDRLGKLFRRCVGKSPTEYRVWARGTPDTPHACGESSGKAQPDHAPSAC
FT                   KEEKVALA"
     atgttcgtcg aaaataactt gcaatggata ccacacaagc atttcagcgc gacgtcaacg        60
     acacaacgaa tcgcgttcat tctcaccgac gcgtgtgatc tgctagggat cggcgcgatc       120
     gcggaggcac tcgaatgcgc gtgctcgctc gagtcgagcg cggcggcgcg aaagtacgag       180
     atgcagttcc tgtcggaacg cggcggacac atccaatgcg atcgatcgat gttcgtctcg       240
     acagaggagt tgccggatag cagcgagacg cggttcgcgc gcgtgttcat cgcgggcggg       300
     gcacaggcga gagaggcttg cgacgccccg cgcgtcgcag catggttgca gcgggtgcgc       360
     gcacaaggcg cacccgtcag gttccttgca gcaggtgtcg aaacgtcgga cctgggcgct       420
     gcaatgggtt cggatggcat agggggcgtg gcgagcggct acgaactcgc gcgccggaga       480
     cgggcgcagt tgggcagcgc cgtcaaggcg gcgttcgaag tgatccgggc ggatttcggc       540
     gagtcgattg cgcacgaggc attgcggcgt attgcattcg tcgattcgac cgaatggctt       600
     tcgccctccg tcgatgcgac gaataccgcg gcagaccgaa tccgcgctgc cgcacgctgg       660
     cttcaggaca actgtcatcg ctcggtcagt attgctgatg ccgccgaagc gtgtgcgatg       720
     agtcagcgca cgttgcttcg caacttccag gcgcatatgg gcgcgtcccc ttccgagtac       780
     ctgcagcgcg tccgcctcga gcgcgcgtgc cagttactgg cggagacgtc actgcctgcg       840
     gacaaggtgg cgcggcgcgt gggactgacg aacggcgatc ggttgggaaa gctgtttcga       900
     cgttgcgtcg gtaagtctcc gaccgaatac cgtgtatggg cgcgcggcac gccagatacg       960
     cctcacgcat gcggcgagtc cagcgggaag gcacagccgg accatgcacc cagtgcatgt      1020
     aaagaagaaa aagttgcctt agcgtaa                                          1047
//

If you have problems or comments...

PBIL Back to PBIL home page