(data stored in ACNUC29543 zone)

EMBL: CP001044.PE604

CP001044.PE604       Location/Qualifiers
FT   CDS_pept        complement(695762..697171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3738"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: bxe:Bxe_B1263 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3738"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72873"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B2JN25"
FT                   /protein_id="ACC72873.1"
FT                   /translation="MFDAALLRKSFAPTVRQTTSSSSGMSHRSVGVVPCSLVYIEADSA
FT                   GSPNCTSVDPYCYVEQAITLNRSLKAVGLPALTVATNVAGQVMHYLEKVDADARPHVVQ
FT                   LSPSALTLPKITRFYSAHFKLDMMEQLGATLHEGELLMVLDTDMLALRPVDEELLLRCQ
FT                   TIGVGAFDISDQEFSAYGDARVIGDLETVAGARLQNPRWFGGEILLASAGFIAALVPRA
FT                   HACFERYTHAIHELNHNGDEAFISAALNLLADEGVPIIDLGAHRVVGRHWSGNTHRDLR
FT                   WFKGCSLLHLPGCKRLLERQARRQGFSAAHVWRSVVVRHEINRTVWPLRRWVRAQVRHR
FT                   MRRGAAQPAARVDVLVLDPDAGRLSQLVSRLTSHGVYVMSALSTEEARNEARRLNPRVI
FT                   VSSSPLGAVDARDLLDTVDARHRPVMIALSTDDARLDWAHWDTWFPGSADPSDVVQAVK
FT                   QALGSRQPHAS"
     atgttcgacg cagcgctctt gcgcaaaagc ttcgcaccca cagtcagaca gacgacatct        60
     tcttcgtccg gcatgtcgca tcgcagcgtt ggagtcgtgc cgtgctcgct cgtctatatc       120
     gaagcggata gtgcgggaag ccccaactgc acgagcgtgg atccatactg ctacgtcgaa       180
     caggccatca cgctgaaccg gagtctcaag gcggtgggcc tgcccgcact gaccgtcgca       240
     acgaatgttg ccggacaggt catgcactac ctggaaaagg tcgatgcaga cgcgcgtccg       300
     catgtcgtac agctgtcgcc atcggcactg acactgccga agatcacgcg cttctacagc       360
     gcgcatttca agctcgacat gatggagcag ttaggcgcga cgctgcatga aggcgagttg       420
     ctcatggtgc tcgataccga catgctcgcg cttcgccccg tcgatgagga actgctgctg       480
     cgctgtcaga cgataggcgt cggtgcgttc gacatttccg accaggagtt ctcggcctat       540
     ggcgatgcgc gtgtcatcgg ggatctcgaa actgttgcgg gcgcgcgttt gcagaacccg       600
     aggtggtttg gcggagagat cctgctggcg tcggcggggt ttattgccgc gctggtgcct       660
     cgcgctcacg cctgcttcga gcgctacacg catgcgattc acgaactgaa tcacaacggc       720
     gacgaggcct tcatttccgc tgcgctgaat ctgcttgccg acgaaggggt gccgatcatc       780
     gatctcggtg cgcatcgcgt cgttggaaga cactggtcgg ggaatacgca ccgcgatctt       840
     cgctggttca aaggatgttc gctgctgcat ctgcccggct gcaagcgctt gctcgagcgt       900
     caggcgcgtc gccaggggtt cagcgcagct cacgtgtggc gcagcgttgt cgtgaggcac       960
     gagatcaatc ggaccgtatg gccgctcagg cgttgggtgc gcgcacaggt ccgtcatcgc      1020
     atgcgtcgcg gcgcagcgca gccggctgca cgcgtcgatg tgctggttct cgatcccgat      1080
     gcgggtcgtt tgtcgcaact ggtttcgcgc ctgacctcgc acggtgtgta cgtcatgtcg      1140
     gcgctctcga cggaagaagc ccgcaacgaa gcgcggcggc tcaacccgcg cgtgatcgtg      1200
     agttcaagcc cgcttggcgc cgtcgatgcg cgcgatctgc tcgacaccgt ggacgcgcgg      1260
     catcggcccg tgatgatcgc gttgtcgacc gacgatgcgc gtctggactg ggcgcactgg      1320
     gatacatggt tcccaggatc cgccgatccg tcggatgtgg tgcaagccgt caagcaggcg      1380
     cttgggtcgc ggcagccgca cgccagctag                                       1410
//

If you have problems or comments...

PBIL Back to PBIL home page