(data stored in ACNUC29543 zone)

EMBL: CP001044.PE607

CP001044.PE607       Location/Qualifiers
FT   CDS_pept        700896..702161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3741"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cac:CAC3280 possible surface protein,
FT                   responsible for cell interaction; contains cell adhesion
FT                   domain and ChW-repeats"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3741"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72876"
FT                   /db_xref="GOA:B2JN28"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR025875"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:B2JN28"
FT                   /protein_id="ACC72876.1"
FT                   /translation="MSEMPPSSTNAAAEDPPASMWRRMTPWAMGGAVVLLLIVLFVAFN
FT                   PTRKSPDERALSELGFIKGTCSDSGTSTAKTESTCLALRAQPTLTASQVAAAVPHLKDS
FT                   DRNIELNLANTQIDNLDALKELDTLESLDLTGTPIWNIDALKDMHSLKRLVLHRTEVEN
FT                   IAALKGLTGLQSLTLWDTRVSNLDALKSLTDLRQLDLRDTQVRDLDPLEDLPRLDTLKL
FT                   GGARNVRDIDALGQLTSLKTLDLNETQVDSIKPLKKLRDMQALYLANTPLRDIDAIKNM
FT                   PSLKTLVLDGSRVDDIDGVRGLQQMDTLVLARTQIANIDALKGLTGLQRLNLADTRVDN
FT                   IDALRDLKNLRMLNLFRTRVRNVDALRGLTNLQELYLANTPIDDVDVLKGLSGLRELVL
FT                   YGTKARNVDDLKAALPKTRIVW"
     gtgtccgaaa tgccgccgtc aagcacgaac gcagccgccg aagatccgcc ggcatccatg        60
     tggcgtcgca tgacgccatg ggcaatgggc ggcgcagtcg tactgctgct catcgttctg       120
     ttcgttgcct tcaacccaac gcgaaagagt ccggatgagc gcgcgctgag tgagcttgga       180
     ttcattaaag gcacctgcag cgacagcggc acttcaacag caaaaaccga atcgacctgc       240
     ctcgcactgc gagcgcagcc gaccttgacg gcgtcgcaag tcgctgccgc cgtgccgcat       300
     ctgaaggatt ccgaccgcaa catcgaattg aatctcgcca acacgcaaat cgacaatctc       360
     gatgcactga aggaactgga cacgctggag tcgctcgatc tgacgggaac gcccatctgg       420
     aacatcgacg cactcaagga catgcattcg ctgaagcggc tggttcttca tcgcacggag       480
     gtcgagaaca tcgccgcgct caaaggattg accggtctgc aatcgcttac gctgtgggac       540
     acgcgtgttt cgaacctcga cgcgctgaag agtctcactg acctgcggca actcgacctg       600
     cgtgacacac aggttcgcga tctcgatccg ctcgaagatc tgcctcgcct ggacacgctt       660
     aagctcggcg gcgcgcgaaa cgtgcgcgac atcgacgcgc tcggccagct cacttcgctg       720
     aaaacactcg accttaacga gactcaggtc gacagcatca agccgttgaa gaaactgcgc       780
     gacatgcagg cgctctatct tgcgaataca ccgctgcgcg acatcgatgc aataaagaac       840
     atgccctcgc tcaagacact cgtgctggac ggctcgcgcg tggacgatat cgatggcgtg       900
     cgcggactgc agcaaatgga cacgctcgtg ctcgcgcgca cgcaaatcgc gaacatcgac       960
     gcgttaaagg gactcacggg cctgcaaaga ctgaatctcg ccgacacacg cgtcgacaat      1020
     atcgatgcgc taagagacct gaaaaacctt cgcatgctga atcttttccg cacgagagtg      1080
     cgaaatgtcg atgcgctgcg gggcttgacg aatctgcaag agctttatct cgcgaatacg      1140
     ccgattgacg acgtcgatgt actcaagggt ttatcgggtt tgcgcgaact cgtcctctat      1200
     ggcacgaagg ccaggaacgt cgacgatctc aaggcggcgc tgccgaaaac acggatcgtc      1260
     tggtaa                                                                 1266
//

If you have problems or comments...

PBIL Back to PBIL home page