(data stored in ACNUC29543 zone)

EMBL: CP001044.PE608

CP001044.PE608       Location/Qualifiers
FT   CDS_pept        702300..702578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3742"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B1529 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3742"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72877"
FT                   /db_xref="UniProtKB/TrEMBL:B2JN29"
FT                   /protein_id="ACC72877.1"
FT                   /translation="MLNWLANLISHHAPTPEKQAERALSELRMGLFQAEQRVLDAQLQA
FT                   DYYRSRIAFCEQVAKGGIEQVSDRRRSPPQEAAVDTLRPSLKLTAAQ"
     atgcttaact ggcttgcaaa cctcatctcc catcacgccc ccacccccga aaaacaggcc        60
     gaacgggcct tgagcgaact tcgaatgggt ctcttccagg ccgaacagcg ggttctggat       120
     gcgcagttgc aggccgatta ttaccgatcc cgcatcgcgt tttgcgaaca ggttgcaaaa       180
     ggcggcatcg agcaggtatc ggatcgtcgc aggagcccgc cgcaagaagc ggccgtcgac       240
     acgctgcgcc caagcctcaa actgaccgcg gcgcaataa                              279
//

If you have problems or comments...

PBIL Back to PBIL home page