(data stored in ACNUC29543 zone)

EMBL: CP001044.PE62

CP001044.PE62        Location/Qualifiers
FT   CDS_pept        72675..73556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3163"
FT                   /product="NmrA family protein"
FT                   /note="PFAM: TrkA-N domain protein; NmrA family protein;
FT                   KEGG: bxe:Bxe_B1674 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3163"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72331"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRK4"
FT                   /protein_id="ACC72331.1"
FT                   /translation="MYVIFGASGNVGRKTAAALRDAGHAVRAVVRNPAHSDMFTGIGCE
FT                   VVQGDLDDEASLHRALHDAHAVQMLCPLPHGGADPAIAMHRMIATAARALRKHPHLHVV
FT                   ALSDYGAEQHEGTGITMLFHDLEAAFAESVRRLTLLRSAEHMHNWARVLPVALATGKLP
FT                   SLHHPLDRPFPTVSAQDVGELAAQLLVEGRDADGVRIVSIEGPRRYDANDVARALSEAA
FT                   RRDITALALPRSEWTPTMLRAGLGANHAKLITDLYDAQNAGCIDVDPRSERRFGKTELP
FT                   GVFAGLVRDARA"
     atgtatgtga tttttggcgc atccggcaac gtgggacgga agacggccgc ggctttgcgt        60
     gatgccgggc acgcggtgcg cgccgtcgtg cgcaaccctg cccatagcga catgttcacg       120
     ggcatcggct gcgaagtcgt gcaaggcgat ctcgacgatg aagcgtcgtt gcatcgcgcg       180
     ctccacgatg cgcatgccgt gcagatgctg tgcccactgc cgcacggcgg cgcggatccc       240
     gccatcgcca tgcatcggat gatcgccaca gccgcgcgtg cattgcgcaa gcatccgcat       300
     ctgcacgtcg tcgcactgtc cgactatggc gccgaacagc atgaaggcac gggcatcacg       360
     atgctgttcc atgatctgga agcggcgttc gcagaaagcg tgcggcgcct cacgctgctg       420
     cgctcggcgg aacacatgca caactgggcg cgcgtgctgc cggtcgcgct tgcgacggga       480
     aagttgccga gcctgcatca tcccctcgac agaccgtttc cgacagtgtc cgcgcaggac       540
     gtcggcgagc ttgccgcgca attgctcgtc gaaggacgcg atgcggacgg cgttcgcatc       600
     gtgagtatcg aaggtccgcg ccggtacgat gccaacgacg tcgcacgcgc gttgagcgaa       660
     gcggcacgac gcgacatcac cgcgctcgcc ctgcctcgca gcgaatggac gccgacgatg       720
     ctgcgcgcgg gcctcggcgc gaatcacgcg aagctcatta cggatctgta cgacgcgcag       780
     aacgccgggt gtatcgatgt cgatccgcgc agcgagcggc gcttcggcaa gacggaactg       840
     cccggtgttt tcgcagggct cgtgcgagac gctcgcgcgt aa                          882
//

If you have problems or comments...

PBIL Back to PBIL home page