(data stored in ACNUC29543 zone)

EMBL: CP001044.PE64

CP001044.PE64        Location/Qualifiers
FT   CDS_pept        complement(75755..76021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3167"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_6674 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3167"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72333"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRK6"
FT                   /protein_id="ACC72333.1"
FT                   /translation="MEKVVASAGWSLRKMVTDWLAPDPTRGFRISHVGRSGLGRYVCVV
FT                   ADNGAESRAMFFYRHRDGKWCIHPPEPERPAMRVTEFAADRET"
     atggagaaag ttgtggcaag cgctggatgg tcattgagaa agatggttac cgattggctc        60
     gctccggacc cgacgagagg gttcagaatc agccatgttg gaaggtccgg tcttggccgc       120
     tacgtctgcg tcgtcgcgga caatggagcg gaatcaaggg cgatgttctt ctatcgtcac       180
     agggatggaa aatggtgcat ccatccacct gagcctgaga ggccggctat gcgggtcaca       240
     gagtttgctg ctgatcgcga aacttga                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page