(data stored in ACNUC29543 zone)

EMBL: CP001044.PE65

CP001044.PE65        Location/Qualifiers
FT   CDS_pept        complement(76349..77254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3168"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="TIGRFAM: transcriptional regulator, ArgP family;
FT                   PFAM: regulatory protein LysR; LysR substrate-binding;
FT                   KEGG: bxe:Bxe_A2670 transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3168"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72334"
FT                   /db_xref="GOA:B2JRK7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR017685"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRK7"
FT                   /protein_id="ACC72334.1"
FT                   /translation="MTELETFAAVVEYRSFSQAAAALSISSAAATRRVKRLERSTGALL
FT                   LTREPTVMPTQAGEKVYRHFVSIRLREDDLLRDIEPGRGGTTALALAINADSLATWFEP
FT                   ITRELVQRHVELEVLVDDQDHTLDALARGDVKGFLSTQKKPVGERFAAEPVGQMRYQCV
FT                   ASPEFSSEYFADGLVLPGVLKAPAILFDRKDRLHDVFLGSYFDTTVGRYIKHYLPSPSA
FT                   LLNAIVDGLGYGLVPAMQSEPLITVGSLVALAPDHDVMIDLYWHHWEEEPEPLAKISAL
FT                   VMDAARRSLVQPIPKGDLDG"
     atgaccgagc ttgagacgtt tgccgcagtg gtcgagtatc gcagtttttc gcaggcggct        60
     gccgcactaa gcatctcgtc tgctgcggcg acgcgtcggg tcaagcgact cgaacggtca       120
     acaggggctc tgctcttgac ccgtgaaccg acagtgatgc cgacgcaggc gggtgaaaaa       180
     gtttatcgtc atttcgtgtc catccggctt cgcgaggacg acttactacg ggatatcgag       240
     cccggaagag gcgggacgac tgcgctggct ctcgcaatca atgctgattc cctcgcgacc       300
     tggttcgagc cgattacgcg cgagctggtc cagcgtcatg tggagctgga ggttctggtc       360
     gatgaccagg atcacacgct cgatgcgctg gcgcgcggag acgtcaaggg ctttctttcg       420
     acgcagaaga agccagtcgg tgagcgtttc gcggccgagc cagtcggaca gatgcgatat       480
     cagtgtgtcg cctcgcccga gttctccagc gaatatttcg cggacggtct ggtcttgccc       540
     ggtgtgctca aggcaccagc cattctgttt gaccggaaag acaggctgca tgacgtattt       600
     ctcggatcat acttcgatac gaccgtaggc agatatatca agcattattt gccttcaccg       660
     tcggcgctgc tcaatgcgat cgtcgatggc ctcgggtatg gccttgtacc cgcgatgcag       720
     tcagagccgc ttatcacggt gggcagcctg gttgcgctcg ccccagatca cgacgtgatg       780
     atcgatctgt actggcatca ctgggaggag gagcccgagc cgctcgcgaa gatcagtgca       840
     ttggtgatgg atgcggcacg tcgaagcctg gttcaaccga tcccaaaggg ggatttggac       900
     gggtga                                                                  906
//

If you have problems or comments...

PBIL Back to PBIL home page