(data stored in ACNUC29543 zone)

EMBL: CP001044.PE66

CP001044.PE66        Location/Qualifiers
FT   CDS_pept        complement(79549..80556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3172"
FT                   /product="quinone oxidoreductase, YhdH/YhfP family"
FT                   /note="TIGRFAM: quinone oxidoreductase, YhdH/YhfP family;
FT                   PFAM: Alcohol dehydrogenase zinc-binding domain protein;
FT                   Alcohol dehydrogenase GroES domain protein; KEGG: ypk:y0204
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3172"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72335"
FT                   /db_xref="GOA:B2JRK8"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014188"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRK8"
FT                   /protein_id="ACC72335.1"
FT                   /translation="MMTQTKAFKAMLLREKDRTTTSANLETLTVDQLPEGDTLVQIDYS
FT                   TLNFKDALAVTGNGKIVKTWPMVPGVDFSGTVVETTHPRLAIGQRVVLTGWSVGEKHWG
FT                   GYSQYQRIRGDWLVPIPEGLDSRLAMMIGTAGFTAMLCVIALERSGVTPTSGAVLVTGA
FT                   GGGVGSVAVTILSALGYSVSALTGDVGKHEYVLSLGAKECVDGPVWKDAPRPLEAQRWS
FT                   AAIDTVGSNVLARVLAEMNYGGTVAACGLAGGPDLPTTVMPFILRGVRLLGVDSVMLPY
FT                   AERLATWQRVSRDLPKAVLERIAARTVSLDEVRDAASDLLSGKLKGRVLVDVNK"
     atgatgacgc aaacgaaagc gttcaaggca atgttattgc gagagaagga taggacgacc        60
     acctcggcga acttggagac actgacggtc gatcagctcc cggagggaga cactctcgtt       120
     cagattgatt actcaacgct taattttaag gacgcgctcg ctgtcacggg gaacgggaag       180
     atcgtgaaga catggcccat ggttcccggc gtcgacttct cgggcaccgt cgtcgaaacc       240
     acgcatccgc ggctcgcgat tggtcagcgc gtggtgctga caggatggag cgtgggcgaa       300
     aaacactggg gtggatatag tcaatatcaa cgtattcgcg gcgactggct tgtgccgatt       360
     cctgagggcc ttgattctcg gctagcaatg atgatcggca cggcaggatt tactgcaatg       420
     ctgtgtgtaa tagcgctgga gcgatccggc gtgactccga cgagtggggc ggtgctcgta       480
     actggagcgg gtggcggggt cggcagtgtc gcggtgacaa tactaagcgc actcggttat       540
     tcggtgagtg cgctaaccgg tgatgttggc aagcacgaat atgttctctc gctcggggcg       600
     aaagagtgtg tcgacggtcc agtctggaaa gacgcgccgc ggccgctcga ggcgcaacgt       660
     tggtcggctg cgatcgatac ggtcgggtcc aacgtgctcg cacgcgtgct cgcggagatg       720
     aactatggtg gcacagtagc ggcgtgtgga cttgcgggcg ggcccgatct gccgacgaca       780
     gtgatgccgt tcatcctgcg cggagtgcga ttgcttgggg tggattcggt gatgttgccg       840
     tatgcagagc gtttggccac ttggcaacgc gttagccgcg atctgccgaa ggcggttctc       900
     gagcgtatcg ccgcccgcac tgtgtcgctc gatgaagtcc gtgacgcggc atcagatcta       960
     ctttcgggaa aacttaaggg gcgcgtactg gtcgacgtca ataagtga                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page