(data stored in ACNUC29543 zone)

EMBL: CP001044.PE69

CP001044.PE69        Location/Qualifiers
FT   CDS_pept        83465..84568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3175"
FT                   /product="NMT1/THI5 like domain protein"
FT                   /note="PFAM: NMT1/THI5 like domain protein; KEGG:
FT                   rpb:RPB_3098 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3175"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72338"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRL1"
FT                   /protein_id="ACC72338.1"
FT                   /translation="MRNQFHRIFVLTLVLYTTFFLDPTYAAGPLKPVRIVVGTQTLNIG
FT                   YPWLTLPQAQALGYWKEEGYDVQVVPLAPPAQPIALLLAGQADFAMVNGAVVVQAHALK
FT                   NEPVKVAMLNGVTDWSIGVLADSPYKSVKDLKGKVIGTFGLASGGVALLRAYFQDNGMD
FT                   PDKDVQIIATGSGAPAIDALRSGRVQALVFWATAMASYENAGLKMRYMRGADWRQIPDY
FT                   SLSVMEKTAQTDPKMVEGIVRGMAKATVFALANPDCARRIQWKTWPSTKPTGSSDDKVL
FT                   AKWDDNVLNAQLATLSDAFTMTGGKYYGNFDPAAYDRLQQFMLRTKQIPKTVPPSDYAL
FT                   QIPDFYGRANSFDAGAIKQASLKCSGW"
     atgcgaaacc aattccatcg aatttttgtc ctcacacttg ttctttacac tacgtttttc        60
     ttagatccta cctacgccgc cggccccctc aaacccgtgc gcattgttgt gggtacacaa       120
     acgctcaaca tcggctatcc gtggcttacg ctgccgcaag cacaggcgct cggctattgg       180
     aaagaagaag gctacgacgt gcaggtagtc ccgctcgcgc ctccagctca acctatcgca       240
     ttgcttctag ccggtcaggc tgatttcgcg atggtcaacg gcgcagtggt tgtacaggcg       300
     catgctctga aaaatgagcc cgtcaaagtt gcaatgctta atggcgtcac tgactggtct       360
     atcggtgtat tggccgattc cccatacaaa tccgtcaagg atctcaaggg caaggttatc       420
     gggacgttcg gccttgcgtc gggcggggtt gcactgttgc gggcttactt tcaggacaat       480
     gggatggatc cggacaagga cgtccagatc atcgcgaccg gcagcggggc accggccatt       540
     gatgcattgc ggtcgggacg cgtgcaggca ctagtcttct gggccactgc catggcgagc       600
     tacgagaacg caggactcaa aatgcgatat atgcgtggag ccgattggcg acagatccct       660
     gactattccc tttccgtaat ggagaagacc gcgcaaacgg accccaaaat ggtcgaaggc       720
     atcgtacgag gcatggcaaa agcgaccgtc tttgcattgg caaatcccga ctgcgcacgc       780
     agaatccaat ggaaaacgtg gccctcgacg aagccgacgg gatcaagcga tgacaaggta       840
     ctcgcaaagt gggatgacaa tgttctgaat gcgcagcttg caaccctgag tgatgcattc       900
     acgatgactg gcgggaagta ctacggcaat ttcgaccccg ccgcatacga ccgactccag       960
     caattcatgt tgcgtaccaa acagattccg aaaaccgttc ccccgtcaga ctacgcgtta      1020
     cagatccccg acttctacgg aagagccaac agcttcgatg ccggcgcgat caaacaggcg      1080
     tcgctcaaat gctccggatg gtga                                             1104
//

If you have problems or comments...

PBIL Back to PBIL home page