(data stored in ACNUC29543 zone)

EMBL: CP001044.PE71

CP001044.PE71        Location/Qualifiers
FT   CDS_pept        87447..89603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3178"
FT                   /product="CoA-binding domain protein"
FT                   /note="PFAM: CoA-binding domain protein; KEGG:
FT                   rle:pRL120177 putative pimeloyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3178"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72340"
FT                   /db_xref="GOA:B2JRL3"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRL3"
FT                   /protein_id="ACC72340.1"
FT                   /translation="MHPLSPLLNPNSIAVLGASPRAEALGNTVIRNLQRIGYAGAIYPV
FT                   HPGAPEVLGIPAYANLDDIPGSVDCAVIALSYDKALPALEALNARGVRNAVLYASGFAE
FT                   TGAEGAALQEELTRYCNQNGINLCGPNCLGLYSVASRVSLYSAALPENLRPGGLALLSH
FT                   SGSACIALSNLDRLGFSHLVSLGNGAVTDIADYLDYVAQDEHTTVAALFIETLRDPEKF
FT                   AVAARKMRAAGKPVVALKVGRSSSGAAASAAHTGALATPDTALQAFFHRLGVVLVEDYD
FT                   ELIETCVLFLGNDRKPKSNGVAVLNVSGGELALTCDIAERVGLTLPDLAPATVNLLREI
FT                   LPPFGAPRNPLDATGVAVFDIDMYGACLRALLADPAISLVAISQDCPSTLGKDQAATYR
FT                   RLVQAVAKVNADAAKPIVFFNNISDTIHPAVLEPLNEASVPSLCGMRNALRAIGHLIDH
FT                   HAHAEVKHTSVGHLRDEQWAERLASGLPFTERESKAFLADHGIAVTREQLATNADDAAS
FT                   AAKRLGFPVVLKIDSEDIPHKTEVGGVVLNLASEAEVATAFDDLIARVRKHMPQAHING
FT                   ALVQQQIDKGIEAIVGIATHKPFGPGVLVGSGGVLVELVKDATFDIAPVTTRDASSMIA
FT                   RTRLADLTRGFRGATPADREALAELVSRLSEVAIVYADELDAMDLNPVSVQPIGKGAIV
FT                   LDALIIPKADNKTPSATNIEEAQT"
     ttgcatccgc tctctcccct tctgaacccg aactctatcg ctgtgctcgg tgcatcacca        60
     cgcgcggaag cgctcggcaa tactgtgatc cgcaatctgc agcgcatcgg ctatgcaggg       120
     gcgatctatc cggtacaccc gggcgccccc gaagtgctgg gcatcccggc ctacgcaaat       180
     ctcgacgata ttcccggttc tgtcgattgt gccgtcatcg cgcttagcta cgacaaggcg       240
     cttcccgcac tcgaggcact taatgcacga ggtgtccgaa acgccgttct gtatgcgagt       300
     gggttcgcag agaccggcgc cgaaggagcg gcactccagg aggaactcac ccgctactgc       360
     aaccagaatg gcatcaatct ctgtggacca aactgcctcg gtctttacag cgtcgcttcg       420
     cgcgtatcgc tctacagtgc tgcgttgcca gaaaacctgc gaccgggcgg cctggcgctg       480
     ctgtcccact ccggatcagc ctgcattgca ctgtcaaatc tcgatcgtct gggcttcagc       540
     catctggtgt cgctcggaaa tggcgccgtg acagacattg ccgactatct cgattatgtc       600
     gcccaggacg agcacacgac agttgcagcg ctttttattg aaaccctgcg cgatccagaa       660
     aagttcgccg tcgcggcaag gaaaatgcgc gcggcgggta aacctgtcgt tgcgctaaag       720
     gtgggccgct caagctctgg cgcagcagcc agcgctgccc acaccggcgc cctcgccacg       780
     ccggacacag cactgcaggc attcttccac cgactcggtg tggtgctggt cgaagactat       840
     gacgaactca ttgagacctg cgtgcttttc ctgggcaatg accgcaagcc gaagagcaac       900
     ggtgtggccg tgcttaacgt cagtggcggt gagcttgcgc tgacctgtga catcgctgaa       960
     cgagtgggtc tcactctgcc cgacctcgcg cccgcgaccg tcaaccttct ccgggagatc      1020
     ctgcctccct ttggcgcacc gcgtaatccg ctcgatgcga caggcgtcgc agtgttcgac      1080
     atcgacatgt atggcgcgtg tctgcgggcg ctgctcgcag atccggccat atcgctggtc      1140
     gcgatttccc aggattgccc gtcgacgctc ggcaaggatc aggcagcgac ctaccggcga      1200
     ctggtccaag cagttgcgaa ggtcaatgca gacgctgcca agccgatcgt gtttttcaac      1260
     aatatctcag acacaattca cccagccgtc ctcgagccac tcaatgaagc gagcgtcccg      1320
     tcgctttgtg gcatgcgcaa tgcactgcgc gccatcgggc atctgatcga tcatcatgca      1380
     cacgcagagg tcaaacacac ttccgtggga catctgcgcg atgagcaatg ggctgaacgg      1440
     ctcgcatcgg gtctgccgtt cacagagcgt gaaagcaaag catttctcgc cgaccacggt      1500
     atcgcagtca ctcgcgagca gctggcaacc aacgccgatg atgcagcaag cgccgccaaa      1560
     cgtcttggct tccctgttgt attgaaaatc gattccgagg acattccaca caagacggaa      1620
     gttggcggtg tggtgctcaa ccttgccagc gaagccgaag tcgccaccgc cttcgacgat      1680
     ctcattgcgc gtgtcagaaa acacatgccg caagcgcaca taaacggcgc actggtgcag      1740
     cagcagattg acaagggcat agaagctatc gtaggcatcg cgacgcacaa gcctttcgga      1800
     ccgggcgttc tggttggctc gggtggcgtg ttggtcgaac tggtgaaaga cgcaactttt      1860
     gatattgcgc cggtcacgac tcgcgatgcg agctccatga ttgcgcgcac acgtctcgcc      1920
     gatctcactc ggggattccg tggtgctaca cccgcagacc gggaagcact cgccgagctc      1980
     gtttcgcgcc tgtccgaagt tgccatcgtc tatgcagacg aactggatgc gatggatctg      2040
     aacccggtat ccgtgcagcc catcggcaag ggcgcgatcg ttctcgacgc gctaatcatc      2100
     cctaaggcgg ataacaaaac gccgtcagca accaatattg aggaggcaca gacgtga         2157
//

If you have problems or comments...

PBIL Back to PBIL home page