(data stored in ACNUC29543 zone)

EMBL: CP001044.PE73

CP001044.PE73        Location/Qualifiers
FT   CDS_pept        90473..91237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3180"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bbt:BBta_7628 ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3180"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72342"
FT                   /db_xref="GOA:B2JRL5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRL5"
FT                   /protein_id="ACC72342.1"
FT                   /translation="MITVSSLNKTYQTREGNEIRALHDVSFDVESGEFITVVGPSGCGK
FT                   STLLKILAGILRRSSGKVAVAGRPIDGPNREVGVVFQAPVLLPWRTVIENILMPSELHG
FT                   KVDKTQRDRAARYLAMVGLEGFEDKYPSELSGGMQQRVGIARALCHDPTLLLMDEPFGA
FT                   LDAMTRESMNLDLLRIRAESGKTVLLVTHSIPEAVFLADRVIVMSPRPGRITDILPVNL
FT                   PRERKLEMINSEPFGAVVSRIRTHFNSHGTLD"
     atgatcacgg tttctagcct taacaagaca tatcagaccc gggagggaaa cgaaattcgc        60
     gcgcttcacg acgtgagctt tgacgttgaa tcgggtgagt tcattacggt cgttggcccg       120
     agcggttgcg gaaaatcgac gctgttaaag attctcgcgg gaatcctgcg gcgttcctcg       180
     ggcaaggtcg ccgtagcggg ccggccgatc gacggtccaa atcgcgaagt cggggtcgtg       240
     ttccaggcac ccgttcttct gccttggcga accgtaatag agaacattct catgccgagc       300
     gagctgcacg gaaaggtcga caagactcag cgggatcgtg ccgcgcggta cctggcaatg       360
     gttggcctgg aaggcttcga ggacaagtat cccagcgaac tgtcaggcgg catgcagcag       420
     cgcgtgggca tcgcgcgcgc tctttgtcac gatcccacac tgcttctaat ggacgagccg       480
     ttcggcgcac tcgatgcaat gacacgcgag tcaatgaacc ttgacctgct gcgcattcgc       540
     gcggagagcg gcaaaaccgt tcttcttgtc acgcacagca ttcccgaagc agtatttctc       600
     gccgatcgtg tgattgtgat gtcaccgcgt ccgggccgga taaccgacat tttgccagtc       660
     aacctgccac gtgaacgcaa gctcgaaatg atcaactctg agccatttgg agctgtagtt       720
     tcgcgcatcc gcacgcattt caactctcac gggaccctcg actga                       765
//

If you have problems or comments...

PBIL Back to PBIL home page