(data stored in ACNUC29543 zone)

EMBL: CP001044.PE75

CP001044.PE75        Location/Qualifiers
FT   CDS_pept        92112..92525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3182"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: abu:Abu_0882 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3182"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72344"
FT                   /db_xref="InterPro:IPR025540"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRL7"
FT                   /protein_id="ACC72344.1"
FT                   /translation="MTTLEKGFTTSLTVTVTEEHLASRLDIDAGERFPNVLSTPWLIAH
FT                   LERAAAKALHPLLQDGQLSVGSRVVFDHFAPTPLGATFTAYAKFTGMEGPLYLFDLWAA
FT                   DAGGAIGKGTHARAVVPGVAVEKRAAKRLGQTA"
     atgacaacac tcgaaaaagg cttcacaact tcgcttacgg taactgttac ggaagaacat        60
     ctcgcaagcc ggctggacat cgatgcaggc gagcgctttc ccaacgtact ttcaactccg       120
     tggctgatcg ctcatctgga gcgagccgca gctaaagcac tgcatccact tctgcaggat       180
     ggtcagctct cggtgggttc gcgcgtggtt tttgaccact tcgcacctac acccctaggg       240
     gcaacgttca cggcttacgc gaagttcacc ggcatggagg gcccgcttta tctttttgac       300
     ctctgggcag cggatgcggg cggcgcgatt ggcaagggca ctcacgcacg cgccgtcgtg       360
     cctggcgttg cggttgagaa gcgtgccgcg aagcgcctcg gtcaaacggc ctga             414
//

If you have problems or comments...

PBIL Back to PBIL home page