(data stored in ACNUC29543 zone)

EMBL: CP001044.PE76

CP001044.PE76        Location/Qualifiers
FT   CDS_pept        92538..93308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3183"
FT                   /product="class II aldolase/adducin family protein"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   KEGG: pol:Bpro_0427 class II aldolase/adducin-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3183"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72345"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRL8"
FT                   /protein_id="ACC72345.1"
FT                   /translation="MAASVSQQVGEERATRDDLAAAYRLIAFLGMDDGIYTHISARVPG
FT                   ADENFLINPFGLLFREVTASSLVKIDLEGKLLEPSDYEVNPAGFTIHSAIHAARPDALC
FT                   VMHTHTIGGVAVSSLEDGLQPTNQWAFQFYDRVAYHEYEGLALDLDERARLVASLGPDK
FT                   RCLILRNHGLLTIGRSVAEAFILMHNLERACRVQLAIQSSGQKVRGVPAEVCERTARQY
FT                   ERGGSSASQLDGIAREWKSFRRLLEAQIGSGYRQ"
     atggcagcga gtgtctcgca acaggtcggc gaagaacgcg caacgcgcga tgatctcgcc        60
     gccgcttacc ggcttatcgc gtttcttggc atggatgacg gtatctatac acatatctcc       120
     gcaagggtgc ctggagcgga tgagaacttt ctgatcaacc cgtttggatt gctgtttcgt       180
     gaggtgacag catcgtccct cgtaaagatc gacctcgaag gaaaactgct cgagccgtct       240
     gactatgagg tgaaccccgc tggcttcacg atccacagtg cgattcatgc cgcgcggcct       300
     gacgctctct gcgtgatgca tactcatacg atcggcggcg tcgcagtctc ctcgctggaa       360
     gacggtcttc agcctacaaa tcaatgggcc ttccagtttt atgatcgcgt ggcctatcac       420
     gaatatgaag gtcttgccct cgacctggat gagcgcgcgc gcctcgtcgc aagcctcggt       480
     ccggacaaac gttgcctgat cctccgcaac cacggcctcc tgacgattgg ccgctccgtg       540
     gctgaagcgt tcatcctgat gcacaacctc gaacgcgcgt gtcgggtaca actggccatt       600
     cagtcgtcgg ggcaaaaggt acgtggagtc ccggcagaag tgtgtgaacg cactgcgcgt       660
     cagtatgaac gcggcggctc cagcgcaagt cagctcgatg gcattgcgcg cgaatggaaa       720
     agttttcgcc gtctgctcga agcgcagatc ggtagtggat accggcaatg a                771
//

If you have problems or comments...

PBIL Back to PBIL home page