(data stored in ACNUC29543 zone)

EMBL: CP001044.PE80

CP001044.PE80        Location/Qualifiers
FT   CDS_pept        complement(96892..97815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3187"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bch:Bcen2424_6218 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3187"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72349"
FT                   /db_xref="GOA:B2JRM2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRM2"
FT                   /protein_id="ACC72349.1"
FT                   /translation="MRTILMSPLMHYVREVALEGSIRRAADNLHISPSAIARQIQQLEE
FT                   QFGAALFERQPRGMRLTEAGQIVLETIQQFERNAASALSHVEELRGLKRGRVSIGALQT
FT                   LGEDILPRALTDLRERYPGICFNAYIGNSSDIIRKVADGDIDIGVCWDPGGAVPIERLR
FT                   VVPIAIGVAMQSGHALAEKDLVSLRDCAPYPMIFPSRDMMFRTLIDRINVGVGSSVTPV
FT                   IETNSMSMMRRLVRDGAGLVLTTSMSLLGDLAVGKVVHRPLLESAVHTFPLCLFVRSDR
FT                   DLPLAVKIVVEQFTLEMDSLAAQHCG"
     atgagaacga tactgatgtc accgctgatg cactatgtgc gcgaggtggc gctggaaggt        60
     tcaatccgtc gagctgccga caacctgcat atttcgcctt ccgcaatcgc ccgccagatc       120
     cagcaactcg aagaacagtt tggtgccgcg ttgttcgagc ggcagccacg cggcatgcgc       180
     ctgaccgaag caggacagat agtgctggaa acaatccagc agttcgagcg caatgctgcg       240
     tccgcgcttt cccacgtcga ggagcttcgt ggccttaagc gtggacgggt ctcgatcgga       300
     gcgttgcaga cgctcggaga ggacatcctg ccgcgcgcat tgacagatct gcgcgaacgg       360
     tatccgggga tatgcttcaa tgcttatatc ggaaattcct ccgacatcat ccgcaaggta       420
     gccgacgggg acattgacat cggcgtgtgc tgggatccag ggggggcggt accaatcgag       480
     cgtctgcgcg tcgttcccat tgcaataggc gtcgcgatgc aaagcggtca cgcgctcgca       540
     gagaaggatt tagtgagtct gcgcgactgc gcgccgtatc ccatgatctt tccgtcacgc       600
     gacatgatgt ttcgcacgtt gattgatcgc ataaacgttg gagtgggtag cagcgttaca       660
     ccggttatcg agaccaactc gatgtccatg atgcggaggc tcgttcggga tggggccgga       720
     ctggtgctga ccacgtcgat gtcgctgctc ggtgatctgg ccgtaggcaa agtagtgcac       780
     cgcccactac tcgagtctgc tgttcacacc tttccactgt gccttttcgt tcgcagcgac       840
     cgtgacctac cgctggccgt gaagatcgtt gtggaacagt tcacgctcga gatggattcg       900
     cttgcggcac agcactgtgg ttga                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page