(data stored in ACNUC29543 zone)

EMBL: CP001044.PE81

CP001044.PE81        Location/Qualifiers
FT   CDS_pept        98076..99416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3188"
FT                   /product="xenobiotic compound monooxygenase, DszA family, A
FT                   subunit"
FT                   /note="KEGG: ava:Ava_4330 xenobiotic compound
FT                   monooxygenase, DszA family, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3188"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72350"
FT                   /db_xref="GOA:B2JRM3"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRM3"
FT                   /protein_id="ACC72350.1"
FT                   /translation="MMKLGGLFHPTGNHIAAWLSPDSQLDAGSNFQHYVKLAKTAEAAR
FT                   FDLLFLADAAAVRGGDLAALSRWPQYMAYFEPTTLLAGIAAMTQHIGLVATATTSYNEP
FT                   YNIARRYASLDHISAGRAGWNVVTSSNLDESMNFGRDEHFSHETRYERAREFVGVVRGL
FT                   WDSWEDDAFIRDRESGVYFRPDSLHTLDHRGTHFSVRGPLNIARPPQGHPVIAQAGSSN
FT                   DGMELAAETAEIVFTAQHTLEKAKAFYDDLKSRMSRYGRQPEQLKIMPGLNPVIGSTRE
FT                   EAKQRHAELQAMIQPEVGLELLSNALGGFDLRGYDLDGPLPGTISAENTNTSKSTVQSV
FT                   LDMANRENLTIRQLYQKMAGARGQRTIIGTPVDIADEMEAWFRAEAVDGFLVQPAVLPG
FT                   DLDVFAATVVPELQRRGLFRTKYEGATLRENLGLTRPANRFTKAGSQ"
     atgatgaaac ttggcggact cttccatccc acgggcaacc acattgccgc gtggctgagt        60
     cctgattccc aactcgacgc gggaagcaac ttccagcact atgtgaaact ggcaaaaacg       120
     gctgaggccg cgcggtttga cctgctgttt cttgccgatg ccgcagctgt gcgaggcggc       180
     gatctagcgg cgctctcgcg ctggccccag tacatggcgt atttcgagcc cacgacgctt       240
     ctggcaggga tcgctgcgat gacgcagcat atcggcctcg ttgcgacagc aaccaccagt       300
     tacaacgagc cgtacaacat cgcacggcgt tacgcctcgc ttgatcacat cagcgctggt       360
     cgggccggct ggaacgtggt cacgtcctcg aaccttgacg agagcatgaa tttcgggcgc       420
     gatgaacact tttctcatga gactcgatac gagcgtgcac gggagtttgt cggcgtcgtt       480
     cgcggcttgt gggacagctg ggaggacgac gccttcattc gagatcgcga atcgggagtc       540
     tatttccggc cagactcgct gcacactctc gatcatcgcg gcacgcattt cagtgtgcgt       600
     ggcccactga acatagcgcg acctccgcag gggcatcccg tgatcgcaca ggcgggctcg       660
     tcaaacgacg ggatggaact cgccgctgaa actgcagaaa tcgtgttcac tgcacagcac       720
     acgcttgaga aggccaaggc tttctacgat gatctgaaaa gccgcatgag ccgttacggc       780
     aggcagccgg agcagctcaa gatcatgccg ggtctcaatc ccgttattgg ctcaacccgc       840
     gaggaggcga agcaacgtca cgcggaactg caggcgatga ttcaaccgga agtcgggctt       900
     gagctcctgt caaatgcact cggagggttt gatctgcgcg ggtacgatct tgacggcccc       960
     ctgccgggca caatcagcgc agaaaacacc aacactagca agagcaccgt tcagtccgtt      1020
     ctcgatatgg caaaccgcga aaatctcacg attcgtcagc tctatcaaaa gatggcgggc      1080
     gcgcgcggtc agcgcacgat tatcggcacc ccggtagata tcgccgacga aatggaagca      1140
     tggtttcgcg ccgaagcggt cgacggcttc ctagttcaac ctgctgtatt gccgggcgac      1200
     cttgatgtat ttgccgcgac ggtggtgccc gaacttcagc ggcgaggatt gttccgaacc      1260
     aaatatgaag gtgccacgct gcgcgagaac ctcgggctga cccgcccggc aaaccgcttt      1320
     acgaaggcag ggagtcagtg a                                                1341
//

If you have problems or comments...

PBIL Back to PBIL home page