(data stored in ACNUC29543 zone)

EMBL: CP001044.PE83

CP001044.PE83        Location/Qualifiers
FT   CDS_pept        100032..100238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3190"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72352"
FT                   /db_xref="GOA:B2JRM5"
FT                   /db_xref="InterPro:IPR021741"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRM5"
FT                   /protein_id="ACC72352.1"
FT                   /translation="MKAVYLLAVLPVLGFFSGTSVVQYWGPLAFGMPTLLLWNLASMIT
FT                   SAAILWIIHTFDAHDTDDSRGES"
     gtgaaagctg tgtatctcct cgccgtacta ccggttctcg gtttcttttc tggcacctcc        60
     gtagtgcagt actgggggcc actcgcgttc ggaatgccga cccttctcct gtggaacctc       120
     gcctcgatga tcacatcggc ggccatcctg tggatcattc acacatttga tgcgcacgac       180
     actgacgact cgcggggtga atcatga                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page