(data stored in ACNUC29543 zone)

EMBL: CP001044.PE85

CP001044.PE85        Location/Qualifiers
FT   CDS_pept        103536..104627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3194"
FT                   /product="ISRSO5-transposase protein"
FT                   /note="KEGG: rso:RSp1675 ISRSO5-transposase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3194"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72354"
FT                   /db_xref="GOA:B2JPF0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:B2JPF0"
FT                   /protein_id="ACC72354.1"
FT                   /translation="MPMGRPKAELELSEDERSQLISIARSRSISAALVTRARIVLAAAD
FT                   GEPNSAIAQRLQLTRATVGKWRLRFLEQRINGLYDEVRPGKPRTIDDERLAQLIHKTLH
FT                   TKPADGSTHWSVRTIAAETAISPTSVHRYFKLLGLQPHRSESFKLSTDQFFIEKLRDVV
FT                   GLYLSPPENALVLCVDEKSQCQALERTQPMLPMGFGYVEGVTHDYVRHGTTTLFAALNV
FT                   LNGAVLATCKPRHRHQEFLSFLREIDKAVPAELDVHCIVDNYSSHKHPKVKAWLAARPR
FT                   WHMHFIPTYSSWLNQVERFFALITDKAIRRGSFGSVKQLIRRIDQFVSHYNENCKPFIW
FT                   TASADSILEKLHRLCSRISGTEH"
     atgccgatgg gacgaccgaa ggccgagttg gagttgagcg aagacgagcg ctcgcaactg        60
     atctcgatag cacgttcccg ctcgatttcg gctgcgctgg tcacgcgtgc gcgcattgta       120
     ctggcggcgg ctgacgggga gcccaacagc gcaatcgcgc agcgcctgca actcacacgc       180
     gccacggtgg gcaagtggcg tctgcgattc ctggagcagc gcatcaacgg actctatgat       240
     gaagtacgcc ccggcaagcc gcgcacgatc gacgatgagc gactggctca gctgatccac       300
     aagaccctgc acaccaagcc tgcggatggc tccacgcact ggagcgtgcg cacaattgca       360
     gccgaaactg ccatctcgcc gacgagtgtg caccgttact tcaagctgct gggtctgcag       420
     ccgcatcgca gcgaaagctt caagctctcg actgatcaat tcttcatcga gaaattgcgc       480
     gacgtggtcg gcctctactt gagtccgccg gagaacgcac tggtattgtg cgtcgacgag       540
     aagagccagt gtcaggccct tgagcgtacg caacccatgc tgccgatggg tttcggctac       600
     gtcgaaggtg tcacgcacga ttatgttcgt cacggcacca ccactttgtt tgcggcactg       660
     aacgtgctca acggtgccgt actcgccacc tgcaagccgc gtcatcgaca tcaggaattc       720
     ctgtcgttcc tgcgcgaaat cgacaaggca gtgccggccg aactcgacgt gcactgtatc       780
     gtcgataact acagcagtca caagcacccg aaggtcaagg catggctggc agcgcgtcct       840
     cgctggcaca tgcatttcat tcccacctac agttcatggc ttaatcaggt cgaacgcttc       900
     ttcgcgctga tcactgacaa ggccatccgg cgcggttcgt tcggttcggt caagcaactg       960
     atcagacgca tcgatcagtt cgtttcccac tacaacgaaa actgcaaacc attcatctgg      1020
     accgcctccg ctgattcaat cctcgaaaag ctacacagac tttgttcgcg aatcagcgga      1080
     acggaacact ag                                                          1092
//

If you have problems or comments...

PBIL Back to PBIL home page