(data stored in ACNUC29543 zone)

EMBL: CP001044.PE86

CP001044.PE86        Location/Qualifiers
FT   CDS_pept        complement(104657..105730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3195"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; KEGG:
FT                   rso:RS02364 putative methyl-accepting chemotaxis transducer
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3195"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72355"
FT                   /db_xref="GOA:B2JRM8"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRM8"
FT                   /protein_id="ACC72355.1"
FT                   /translation="MVLLGLWELATVVYRVEPGSHVTRLLSIAMVVLATTGCVFSIYCG
FT                   VHLHSVVCGGLNRMGKRLEDIAATLDLSKRSSSPRMDEFGRAAVAFDALMLRIQEAVSD
FT                   VSLSTDTVSRATRALVSGNLDISARTEEQAASLQETASSMTQLTETVKQNADNARCAKD
FT                   EVAKANRIVERSGKVVHEMVATMEKIYGSSSKISEITGVIEGIAFQTNILALNAAVEAA
FT                   RAGEQGRGFAVVASEVRGLAQRSASAAREIKELIGTSVATISEGSKQADRVSVAMDEMK
FT                   AAIENASQMVDEIASASEQQSQGIEQVNQAVILMEQVTQRNAAVIEQGAIAAQALEEET
FT                   HRLEATVTSFKISQDPG"
     atggtcctgc tgggactatg ggaactggcc acagttgttt acagggtcga accaggatcg        60
     catgttaccc gtttactctc gattgctatg gtcgtccttg cgacgactgg atgcgtcttt       120
     tcgatctact gcggtgtgca tctacattca gttgtctgtg gaggactgaa tcggatgggg       180
     aaaaggcttg aggatattgc cgcaacactc gacttgtcca agcgctcttc aagcccgcgg       240
     atggatgagt ttggacgtgc agctgtggca tttgacgcgt taatgctaag aattcaggag       300
     gcagtttccg atgtgagtct gtcgactgac accgtctcaa gggccacgcg agcccttgta       360
     tccggaaatc tcgacatttc tgcgcggacg gaagagcagg cggcgtcgtt gcaggagaca       420
     gcgtcgagta tgacgcaatt gacggaaaca gtgaaacaga atgccgacaa cgcgcggtgt       480
     gcgaaggacg aggttgcgaa ggcaaacagg atcgtggaga gaagcggcaa ggtcgtccat       540
     gaaatggtcg caacgatgga gaagatttat gggagctcga gcaaaatctc ggagataaca       600
     ggagtcatcg agggaatcgc attccagacc aatatcctgg cactgaatgc ggccgtcgaa       660
     gctgcccgtg caggcgaaca gggaagagga tttgccgttg tcgcgagtga agtacggggt       720
     ctcgcccagc ggtctgcatc cgcggcgagg gagataaagg aattgattgg cacgtcggta       780
     gcgacgatta gcgagggatc aaagcaggcc gatagagtca gcgtggcaat ggatgaaatg       840
     aaggcagcaa tcgagaatgc atctcagatg gtagatgaga ttgccagcgc ttcggaacaa       900
     caaagtcaag gtatcgaaca ggtgaaccag gcggttattt tgatggagca ggtgacgcag       960
     cggaatgctg cggtgattga gcaaggggcg attgcagccc aggcgcttga ggaggagaca      1020
     caccggctag aagcgacggt tacatcattc aagatttcgc aggaccctgg ttag            1074
//

If you have problems or comments...

PBIL Back to PBIL home page