(data stored in ACNUC29543 zone)

EMBL: CP001044.PE87

CP001044.PE87        Location/Qualifiers
FT   CDS_pept        complement(105992..107077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3196"
FT                   /product="outer membrane protein (porin)"
FT                   /note="KEGG: bam:Bamb_1076 outer membrane protein (porin)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3196"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72356"
FT                   /db_xref="GOA:B2JRM9"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRM9"
FT                   /protein_id="ACC72356.1"
FT                   /translation="MKTIRSLSLISVSALVAGSACAQSNVTLYGIVDTGVQYYNNATAS
FT                   GGSVVGMPSLSGKLPSRFGLRGVEDLGGGYKAFFVLENGFAVNNGALGYGGRIFGRAAN
FT                   VGIDSRFGTLTLGRQMNMTLYALTDADVIGPSNHSLAVFDTYLPNARSDNAVGYMGKWH
FT                   GFTIGATYSFGRDAAGPAGPSATNCAGQVPGDFVACRQYTVMLAYASETLGVTASYDVM
FT                   RGGTGASAPLSSSANTDTRTIVDGYAKYGNLKLGAGWIRRNTSSTTHSQSDIFFAGGTY
FT                   LLTPAFAVDAQAVRYILRTRSDATLFVGRVSYFLSKRTSIYSSAGYMINSPTSAVPVSA
FT                   GGTVGIGKNQVGFMVGMQQRF"
     atgaaaacga taaggagtct aagtttgata tcggtttctg ctttggttgc cggcagtgct        60
     tgcgctcaaa gcaacgttac gttatacgga atcgttgata caggtgtgca atattacaac       120
     aacgccacag cttcaggcgg atcagtcgtc ggaatgccga gcctctcagg gaaactgccg       180
     tcgcgttttg gtctgcgggg cgtagaagat ctaggcggtg ggtataaggc gttcttcgtc       240
     ctcgaaaatg gttttgcagt gaacaacggt gcgctagggt acggtggaag aatattcggg       300
     cgtgccgcaa acgttggaat tgatagcagg ttcggaacct tgacgttggg cagacagatg       360
     aacatgacgt tatacgcgct taccgacgcc gacgtcatag gaccgtctaa ccactccttg       420
     gcggtttttg acacatatct gccaaatgct cgcagcgaca acgcagtggg gtatatgggg       480
     aaatggcacg gcttcactat cggtgcgact tatagttttg gtcgagatgc agccgggcct       540
     gctggcccgt ctgcgaccaa ctgtgcgggc caggttcctg gtgacttcgt cgcgtgtcgg       600
     cagtacacgg tcatgctcgc ctatgcctcg gagacactcg gtgtcactgc gtcatatgac       660
     gtcatgcgcg gaggtacggg agcgtcagcg ccgctatcaa gcagcgccaa tacggacaca       720
     cggacaatcg ttgacggcta cgcaaaatac ggaaacctga agttgggagc agggtggatc       780
     aggcgaaata cgtcgagcac gactcatagt caatcggaca tcttcttcgc gggtggtacc       840
     tatctgttga cacccgcatt cgcagttgac gcgcaggcgg ttaggtacat attgcggacg       900
     cgttcggacg cgacactgtt tgttgggcgc gtaagctact ttctttcaaa acgaacgtca       960
     atctattcat ctgctggtta tatgatcaac agtcccactt cggcagtccc ggtatcggcg      1020
     ggcggcaccg tcggaatagg taagaatcag gtgggtttca tggttggtat gcagcagcgt      1080
     ttctaa                                                                 1086
//

If you have problems or comments...

PBIL Back to PBIL home page