(data stored in ACNUC29543 zone)

EMBL: CP001044.PE90

CP001044.PE90        Location/Qualifiers
FT   CDS_pept        complement(110411..111595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3199"
FT                   /product="membrane protein involved in aromatic hydrocarbon
FT                   degradation"
FT                   /note="PFAM: membrane protein involved in aromatic
FT                   hydrocarbon degradation; KEGG: bur:Bcep18194_B3106 membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3199"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72359"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRN2"
FT                   /protein_id="ACC72359.1"
FT                   /translation="MSMQFGSQGCARALAAGVVIALYAGKALAVDGIALSGTGVKAAGM
FT                   AGTSIAFPQESSSAADNPAGMGLIGSRTDFGIQVLEPLTDFEYGSPSNTLHTGKVYPVP
FT                   DGGANWQINPRLTFGVSLFGTGVGTSYGRPALTVPGAGVAKSSLQTMIAAPTVTWRLTE
FT                   HNIIGIGLSLAYQRFSANGAIVPADDGTLQPLPSHGTANAFGYGIRVGYIWQPASTFTL
FT                   GASYASRIRMSKLSGYENDLLAAGGGRIDIGAQYGIGVAYKVIPSVTLAADWLHMEFSN
FT                   TIIGSAQGFGWQDQDFFRIGVSWDVNQRWTLRTGFSHGNHPIGPSVVAQNLLAAMPVST
FT                   SVAVGATYRIGERDGVSGIFEYGFPVTVKGEGASLGFNEQTKTEVFGVSYGHKF"
     atgtcgatgc aattcggttc gcagggatgt gcgcgagcgt tagctgctgg tgtagttata        60
     gcgctttacg ctgggaaggc tctcgcagtt gatgggatcg cactaagcgg tactggagta       120
     aaagctgcag ggatggccgg gacgtcaatc gcattcccac aggagagctc ttctgcagcc       180
     gataatcccg ccgggatggg cttaatcggt tcacggactg actttggaat tcaggtactg       240
     gagccgttga cagatttcga gtatggaagt ccctcgaaca ctctgcatac gggaaaggta       300
     tacccggttc cagatggcgg ggcaaattgg caaataaatc cgagattaac attcggtgtt       360
     tctctcttcg gtacgggtgt cggcactagc tacgggcgtc cggcgctcac agtgccggga       420
     gccggtgttg cgaaatccag tctgcagaca atgatcgccg ctccaacggt gacctggcgg       480
     ctcaccgagc acaacattat cggtatcggt ctatcgttgg cctatcagcg gttctccgct       540
     aacggggcaa tcgttccagc agacgacggt accctccagc cgctaccttc gcacgggacc       600
     gcaaatgcgt ttggatatgg gatacgtgtc ggctatatct ggcaaccggc gtctacgttc       660
     accctcggcg caagctacgc cagtcgtata cgaatgagca agctgtctgg gtacgaaaac       720
     gatctcctgg cggcgggagg aggccgcatc gacattggtg cgcagtatgg aatcggtgtc       780
     gcctataagg taattccgag cgttaccctt gctgctgatt ggttgcacat ggaattctcc       840
     aatacgatta tcggatcggc acaagggttc ggttggcagg atcaggactt ctttcggatt       900
     ggtgtctcgt gggatgtcaa tcagcgctgg acgttgcgta ctggattttc acacggcaat       960
     catccaatag gaccttcggt agttgctcag aatctgctcg cggccatgcc ggtttcgaca      1020
     tcagttgcag tcggtgcaac atacaggatc ggcgaaaggg atggggtaag cggaatattc      1080
     gagtacggat ttccggtcac ggtcaaaggc gagggcgcaa gcctcggatt taacgagcag      1140
     acaaaaacgg aggtcttcgg tgtgagctat ggacacaagt tctag                      1185
//

If you have problems or comments...

PBIL Back to PBIL home page