(data stored in ACNUC29543 zone)

EMBL: CP001044.PE94

CP001044.PE94        Location/Qualifiers
FT   CDS_pept        complement(115395..116342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3203"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: dac:Daci_4444 oxidoreductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3203"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72363"
FT                   /db_xref="GOA:B2JRN6"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRN6"
FT                   /protein_id="ACC72363.1"
FT                   /translation="MTKPLRIGLMGAGAIGIQHLEALSMLENVEVVSIAGKEAPRIEDL
FT                   ATRYGIGHVCSDLPEMLSLREVEAVILCTPTPMHSDQAVLCLESGRHVLVEIPLADSLL
FT                   GAQAVVQSQQRTGLVAMCAHTRRFNSGHRWLHERIERGAFVLRQLDVQTHFLRRSNLNA
FT                   LGQQRTWTDHLLWHHAAHTVDLFQYQTGEKVQVAHALQGPVHSELGVALDLSIQMKTGS
FT                   GALCTLSLSFNNQGPFGSTFRYIGDGETYVARYDSLIDGCGAKIELDDQLLSGIAAQDQ
FT                   EFIAAIRELREPNASLASVMPCYQLLQELESQLI"
     gtgactaagc cattgcgaat tgggctcatg ggtgccggtg cgataggtat ccagcacctg        60
     gaggcactat ccatgctcga gaacgtcgaa gtggtttcga ttgccggaaa ggaagctccc       120
     cggatcgagg atctggcgac tcgttatggt atcggacatg tttgttcgga tctcccggaa       180
     atgctctcgc tccgggaagt cgaagcagtc attctctgta cgcccacccc catgcattcg       240
     gaccaagccg tgctgtgtct cgaatctgga aggcatgtct tggtggagat tccgctcgct       300
     gattcgttgt tgggggcgca agccgttgtg caaagtcagc aacgcacagg actggttgca       360
     atgtgcgcgc acacacgacg attcaattca gggcataggt ggctacacga aaggattgaa       420
     cgaggtgcgt tcgtgttgcg tcaactggac gtacaaactc acttcttgcg acgtagcaat       480
     ttgaacgcgt taggccaaca gcgcacctgg acggaccatc ttctgtggca tcacgcggcg       540
     catactgttg acctgtttca atatcagacg ggggaaaagg tacaggtcgc tcacgcatta       600
     caaggacctg tccattccga actgggtgtc gcgctcgatc tgtcgataca gatgaagacc       660
     gggtcagggg cgctgtgcac gctgtcgctc agcttcaata atcaaggtcc gttcggatcg       720
     actttccgtt acatcggaga cggggaaacg tacgtggccc gctacgatag cctgatcgac       780
     gggtgcggtg caaaaattga gcttgatgat cagctgttga gtggaattgc cgcgcaagac       840
     caggagttta ttgcagctat ccgggagcta cgtgaaccga atgcgagcct ggcgagcgtg       900
     atgccgtgct atcagctact ccaggaactc gagagccagt tgatctga                    948
//

If you have problems or comments...

PBIL Back to PBIL home page