(data stored in ACNUC29543 zone)

EMBL: CP001044.PE95

CP001044.PE95        Location/Qualifiers
FT   CDS_pept        complement(116339..117181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3204"
FT                   /product="Protocatechuate 4,5-dioxygenase"
FT                   /EC_number="1.13.11.8"
FT                   /note="PFAM: Extradiol ring-cleavage dioxygenase class III
FT                   protein subunit B; KEGG: pat:Patl_3885 protocatechuate
FT                   4,5-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3204"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72364"
FT                   /db_xref="GOA:B2JRN7"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR034937"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRN7"
FT                   /protein_id="ACC72364.1"
FT                   /translation="MARIIGGVGTSHVPSIGAAIDHGKVDDPYWRPLFEGVQPARKWIE
FT                   KMKPDVAIVVYNDHASRFALDMTPTFAIGMGERFSPHDEGYGPRPVPVCQGDPALAWHL
FT                   AESLVLKDEFDIAMVSEMTVDHGLTVPLSLLFGQPEAWPCRIIPLCVNVIQYPQPTALR
FT                   CLRLGQALRRAIDAYEPDLKVAIFGTGGMSHQLQGERAGLINADYDKMWLDKMESDPQS
FT                   LARISHTELLREAGSEGLEIIMWLIMRGALDSSVRRIHRFYHVPASNTAYGMLIMENA"
     atggctagga taatcggcgg cgtcgggacg tcacatgtgc cgtccatcgg cgctgcgatt        60
     gatcacggca aggtcgacga tccctactgg cgcccgctct tcgaaggagt gcagccagct       120
     cgtaaatgga tcgaaaagat gaagccggat gttgcgatcg tcgtgtacaa cgaccatgca       180
     tcgaggttcg ctctggacat gaccccgact ttcgcgatcg gcatgggtga gcggttcagc       240
     ccgcatgacg agggatatgg gccacggccg gtgccagtct gccagggcga tccggcactc       300
     gcgtggcatc ttgccgaatc gcttgtgttg aaggatgagt ttgatattgc gatggtcagt       360
     gagatgacgg tggatcacgg gctaaccgta cctctctcgc ttctgtttgg ccaacccgag       420
     gcttggccat gcagaatcat tccattgtgc gtcaacgtga ttcagtatcc tcagcccaca       480
     gcgctgcgat gtcttcgtct tgggcaggcc ttgcggcgag ccattgatgc gtacgagccc       540
     gatctgaagg tcgccatctt cggaacaggg gggatgtcac atcaattgca aggagagagg       600
     gcgggtctga tcaatgcaga ttacgacaag atgtggctcg acaaaatgga aagcgatccg       660
     caatcactcg ccaggatcag tcatacggag ctcctgcgcg aggcgggctc ggaagggttg       720
     gaaattatta tgtggctgat catgcgcggg gcgctcgatt cgtcggtccg tcgtattcat       780
     cgcttctatc atgtgccagc atccaacacc gcatacggca tgctgataat ggagaatgcg       840
     tga                                                                     843
//

If you have problems or comments...

PBIL Back to PBIL home page