(data stored in ACNUC7421 zone)

EMBL: CP001053.PE10

CP001053.PE10        Location/Qualifiers
FT   CDS_pept        9760..12342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_3999"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; KEGG:
FT                   bxe:Bxe_B0472 putative forkhead-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_3999"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18385"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE64"
FT                   /protein_id="ACD18385.1"
FT                   /translation="MAAGEAPIAEMRATEDAAFDVVLSPIASAQRPALDAIRIVDNLFA
FT                   IGRSEAPFTDYPAERIARLSRRHARVFTEHGAVYVADLGSKNGTTVNGVAVRQTPARVR
FT                   AGDELCFGGELCYRVSIEPRARIVAAASPSAAPGLLLVPQRDDLGLQPIEVQAFPFLVS
FT                   KADEVFSRYKDRYPHQVNYISRRHAHIFLKGGELYVEDLGSTNGTFVGGKRLDESALPL
FT                   VEGDLVAFGGDHFVYRVSLQKPPEVEPTVTQLFVNPAANEAVDPDKTTFVGAAHSFLDI
FT                   FCVDPGLQREDEVNEAAQAASAHAKRDAPTGTAKAASGTNGANGANGAANAAAAKSRPR
FT                   RWRLVAGELGKAFAIDDRASVRRMATWGGVGVVVLAAIATTLYMRGSSERELKNLLANG
FT                   DYTSAVTAASGYLASHPADTKVKALASEALLKAKLPSWLNALQKAQFDQADALLKEMRS
FT                   LSANNADAASLVNELQWVGDLERFVAARGGMDAPIRMYADEGTINNLLQRWEDDARSHQ
FT                   RALDRIASYVPVFADPYAQALSHLRKLESDDSVYLAAIDRLNGTIRTELARDKPDALPP
FT                   VLDDYTQRYPRLAGIDRVRQDLRQYTDLLNAALSRQLVPLLAMLKTARFSTPPFQAQFQ
FT                   QLAASRLPSPDVIARHDAVTAAWQHGDAQQALAGLQAMPAGPWSDVLAAELAHKKTLLD
FT                   QYAQLQKTRGDKDYDQRLLSFYASLDPATDVWFLQSIQKDVAALHDKALARAQDLLLRA
FT                   QSLWKQYRAGGSIGGTQRLEAGISPGFRSEARLLSDAKTSAQQGMRIYTQLKADHPADF
FT                   DRLLADIEAEANLQRRSLTELRMVLDPGLLKAKLALIGGEQSETRQSP"
     atggccgccg gcgaagctcc gattgctgag atgcgcgcga cagaagacgc cgcgttcgac        60
     gtggtgttgt cgccgattgc gtccgcgcaa cgtccggcgc tcgacgcgat ccgtatcgtc       120
     gacaacctgt ttgcaatcgg gcgcagcgaa gcacctttta ccgactatcc cgccgagcgg       180
     attgcccgcc tgtcgcgccg tcatgcgcgg gttttcacgg aacacggcgc ggtctacgtt       240
     gccgacctgg gcagcaagaa cggcacgaca gtgaacggcg tggcggtgcg gcagacgccg       300
     gcccgtgtgc gcgccggcga cgaattgtgc tttggcggcg agctctgcta ccgcgtcagc       360
     atcgaaccgc gcgcgcgtat cgtggcggcc gccagtccgt ccgccgcgcc gggattgctg       420
     ctggtgccgc agcgcgacga cctcggcctg caacctatcg aggtgcaggc atttccgttt       480
     ctggtcagca aagccgatga agtcttctcg cgctacaaag accgctatcc gcatcaggtc       540
     aactacattt cgcgccgtca cgcgcacatc tttctgaagg gcggcgaact ctatgtcgag       600
     gatctcggca gcaccaacgg cacattcgtc ggtggaaagc ggttggatga atccgcgctg       660
     ccgctggtag agggagacct cgttgcattt ggcggagacc acttcgtcta cagggtgtcg       720
     ctgcagaaac cccctgaagt cgagcccacc gtgacacaac tattcgtcaa tccggccgcc       780
     aacgaagcgg tggatcccga caagaccacc ttcgtcggcg ccgcgcattc attcctcgat       840
     atcttttgcg tcgaccccgg ccttcagcgt gaagacgagg tcaacgaggc ggcacaggcc       900
     gcgtccgcgc atgcgaagcg cgatgcgccg acgggcacgg caaaagcggc gagtggcacg       960
     aacggcgcca acggtgcgaa tggcgctgcc aacgcggctg ccgcgaaaag ccggccgcgc      1020
     cgttggcggt tggtcgcggg cgaactcggc aaggcgtttg cgatcgacga ccgcgcgagc      1080
     gtgcggcgca tggcgacatg gggcggcgtg ggcgtcgtgg tgttggcggc gatagcaacg      1140
     acgctatata tgcgcggttc ttcggaacgc gagttgaaga atctgctggc gaacggcgat      1200
     tacacgagcg cggtcacggc ggcatcgggc tatctggcga gccatcccgc ggacacgaaa      1260
     gtcaaggcac tcgctagcga agcgttgttg aaggcaaagc tccctagttg gctgaatgcg      1320
     ctgcaaaagg cgcagttcga tcaagccgac gcgttgctca aggagatgcg ttcgttgagc      1380
     gcgaacaacg cggacgcggc gtcgctggtc aacgaattgc aatgggtagg cgatctggag      1440
     cgtttcgtcg cggcgcgcgg cggcatggac gcgcctattc gcatgtacgc ggacgaaggc      1500
     acgatcaaca atctgctgca acgctgggaa gacgacgcga ggagccatca gcgcgcgctc      1560
     gaccgcattg cctcctatgt gcccgtgttc gccgatccct atgcacaggc gctgagtcat      1620
     ctgcgcaaac tggaaagcga cgattcggtg tacctcgccg ccatcgaccg tctgaacggg      1680
     acgatccgca ccgaactggc gcgcgataaa cccgacgcgc tgccgccggt gctcgacgat      1740
     tacacgcagc gttatccgcg tctcgcgggc attgaccggg tgcgtcagga tctgcgccaa      1800
     tacaccgatt tgctgaacgc cgcgctgagc cggcaactgg tgccgttgct cgcgatgctg      1860
     aaaacggcgc gcttcagcac gccgcctttt caggcgcagt ttcaacaatt ggccgcgagc      1920
     cgtttgcctt cgccagacgt gattgcgcgc cacgatgcgg tgacggcggc atggcagcac      1980
     ggcgacgcgc aacaggcgct cgccggtcta caggccatgc ccgcggggcc ttggtccgac      2040
     gtgctcgcgg cggaactcgc ccacaagaaa acgctgctcg accaatacgc gcaactgcag      2100
     aaaacgcgcg gcgacaagga ctacgaccag cgtctcctgt cgttttacgc aagcctcgat      2160
     ccggcaacgg acgtgtggtt cctgcagtcg atccagaaag acgtcgccgc gttgcacgac      2220
     aaagcgctgg cgcgtgcgca agacctgctg ctgcgcgctc agagtctgtg gaaacagtac      2280
     cgcgcgggcg gatcgatcgg cggtacgcag cgtctcgaag ccggcatttc accgggattt      2340
     cgcagtgagg cgcgtctgct ttcggatgcg aaaacgtcgg cgcaacaggg catgcgcatc      2400
     tacacgcaac tgaaggccga tcatccggcc gacttcgacc gtctgctggc agacatcgaa      2460
     gccgaagcca atttgcagcg ccgctcgcta acggagttgc gcatggtgct ggatccggga      2520
     cttctaaaag cgaagctggc attgatcgga ggcgagcaga gtgaaacgcg acagtcaccc      2580
     tag                                                                    2583
//

If you have problems or comments...

PBIL Back to PBIL home page