(data stored in ACNUC7421 zone)

EMBL: CP001053.PE100

CP001053.PE100       Location/Qualifiers
FT   CDS_pept        129604..130962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4091"
FT                   /product="protein of unknown function DUF1446"
FT                   /note="PFAM: protein of unknown function DUF1446; KEGG:
FT                   bcm:Bcenmc03_1346 protein of unknown function DUF1446"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4091"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18475"
FT                   /db_xref="InterPro:IPR010839"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEF4"
FT                   /protein_id="ACD18475.1"
FT                   /translation="MTATQPQRRVRIGAGAGYSGDRIEPAVELAQYGALDYLVFECLAE
FT                   RTIAIAQQARSKDPELGYDPLLETRMKAVLPAALRNGVRIISNMGAANPLAAARKTAEI
FT                   ARSLGLGDVKIAAVTGDDVLDVVRQGDFCFVESGERVADYKDRLVSANAYLGASAIVDA
FT                   LAAGAQIVLTGRVADPSLFVAPLIHEFGWRMDDWQTLGQATVIGHLLECAGQITGGYFA
FT                   DPGFKDVPELARLGFPIAEVGQDGGVVITKLAQAGGRVTEATCKEQLLYEIHDPQRYLQ
FT                   PDVVADFSQVRVAQEAPDRVRVSGGRGTPRTDTLKVSVAYFDGYIGEGQISYGGPGAFA
FT                   RARLALDIVRERLVLTGVQTRELRFDLIGVNALHGETAAVGYAEPYEVRARVAGRTTSL
FT                   AQAVQIGNEVETLYTNGPAGGGGVTKSAREVVAVQSVLLPREHVTPAFSMVEA"
     atgacagcta ctcaacctca acgtagggta cgcatcgggg cgggcgcggg ttattcaggc        60
     gaccgtattg aaccggcggt cgaactggcg caatacggcg cgctcgatta cctcgtgttc       120
     gagtgcctcg cggaacgcac gattgcgatc gcgcagcagg cgcgcagcaa ggaccctgaa       180
     ctcggctacg acccgctgct cgaaacacgc atgaaggcgg tattgccggc cgcgttgcgc       240
     aacggcgtgc ggatcatttc gaacatgggt gccgcgaatc cgctcgcggc ggcgcgcaag       300
     accgcggaga tcgcgcgctc gctcggtctc ggcgacgtga agatcgccgc agtcaccggc       360
     gacgatgtgc tcgacgtggt gcgccaaggc gatttctgtt tcgtggaatc gggagaacgc       420
     gtcgcggact acaaggatcg gctcgtgtcc gcgaacgcgt atctcggcgc gagcgcgatc       480
     gtcgatgcgc tcgcggccgg tgcgcagatc gtgttgaccg gacgcgtggc cgatccgtcg       540
     ctgttcgtcg cgccgctgat tcacgaattc ggctggcgca tggacgactg gcagacgctc       600
     ggccaggcga cggtgatcgg ccatctgctc gaatgcgcgg ggcaaatcac cggcggctat       660
     ttcgcggatc ctggtttcaa ggatgtccct gaactggcga ggctcggttt tcccatcgcc       720
     gaagtcgggc aggacggcgg ggtggtcatt accaagctgg cgcaagccgg cggacgcgtc       780
     accgaggcga cctgcaagga acaactgctg tacgagattc acgatccgca gcgctatctg       840
     caaccggacg tggtcgcgga tttctcgcag gtgcgtgtcg cgcaggaagc gccggatcgc       900
     gttcgcgtga gcggcgggcg aggcacgccg cgtacggata cgctgaaggt gtcggtggct       960
     tatttcgatg gctatatcgg cgaagggcaa atttcctatg gcggtcctgg cgcgttcgcg      1020
     cgcgcgcggc tcgcactcga tatcgtgcgg gagcggctcg tgttgaccgg cgtgcagacg      1080
     cgtgaattgc gtttcgatct gatcggtgtg aacgctttgc acggcgaaac cgcagcagtg      1140
     ggttacgccg agccgtacga agtgcgcgcg cgagtggcgg ggcgcacgac ctcgctcgct      1200
     caggccgtgc agatcggcaa cgaggtggag acgctttata ccaacggtcc ggcaggcgga      1260
     ggcggcgtca cgaagtcagc gcgcgaagtc gtcgcggtgc aatcggtttt gctgccgcgc      1320
     gagcatgtga cgccggcgtt ttcgatggtg gaggcgtga                             1359
//

If you have problems or comments...

PBIL Back to PBIL home page