(data stored in ACNUC7421 zone)

EMBL: CP001053.PE102

CP001053.PE102       Location/Qualifiers
FT   CDS_pept        complement(131304..132338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4093"
FT                   /product="transcriptional regulator, LysR family"
FT                   /EC_number="4.2.1.1"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: ppw:PputW619_1688 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4093"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18477"
FT                   /db_xref="GOA:B2TEF6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEF6"
FT                   /protein_id="ACD18477.1"
FT                   /translation="MGNVAPLHRDRRATRYHRSATAGARPLIHIAHTCWGNLDLALGNI
FT                   NDIATFVTVVKAGSFTSAGQQLGITRSAVGKIIARLEARLQVRLLHRTPHSLGLTDDGS
FT                   VFYGRCTQILEDLEETETAMAVRSATPAGSLRISLPIALGHRQVLPIIALFLERWPAVS
FT                   AEVSFTDRFVDLVDEGIDVAIRVGEPKPDSRLIARTVATQKLITCASPVYLAKRGAPVS
FT                   PLDLAHHECLQFVSAGRPQPWLFAGVGQQAVEAGGRLKMDSAEALIGAAVNGVGIINLP
FT                   NYLVANEIRQGHLQPLLQSFAAQALPIRAIYPTRRHLTPKVRLFIDELIEAWQPVPPWE
FT                   EADA"
     atggggaatg tggctcccct tcatcgcgac agacgggcga cgcgctatca tcggagcgcg        60
     acggctggcg cgcggccgct cattcacatt gcacacacct gttgggggaa tctcgacttg       120
     gcgctcggca acatcaacga catcgcgacc ttcgtcaccg tggtcaaggc cggcagcttt       180
     acgtcggcgg gacagcaact cggtattacg cgctcggcgg tcggcaagat cattgcccgt       240
     ctcgaagcgc gcttgcaggt gcgcctgctg caccgaacgc cgcacagcct gggactcacg       300
     gacgacggct ccgtgtttta cggtcgctgc acgcagattc tcgaagacct cgaagagacc       360
     gaaacggcca tggcggtgcg cagcgcgaca ccggcaggct cattgcgcat cagcctgccg       420
     atcgccctcg gtcaccgtca ggtgttgccg atcatcgcgt tgtttctgga acgctggccc       480
     gcggtcagcg ccgaggtgag cttcacggac cgcttcgtcg atctcgtcga cgaggggatc       540
     gacgtcgcca tccgcgtcgg cgaaccgaaa ccggactcgc ggctcatcgc gcgcacggtg       600
     gccacgcaaa agctgatcac gtgtgcgtcg ccggtttatc tcgcgaagcg tggtgcgcct       660
     gtctcgccgc tcgatctcgc gcaccacgag tgcctgcaat tcgtcagcgc gggacgtccg       720
     caaccctggc ttttcgcggg cgtcgggcaa caggcggtgg aggccggcgg cagattgaag       780
     atggacagcg ccgaggcgtt gatcggcgcg gctgtgaatg gtgtgggcat catcaatctg       840
     cccaactatc tggttgcgaa cgagatccgc cagggccatt tgcaaccgct gctgcaatcg       900
     ttcgcagcgc aagcgctgcc gattcgcgcg atctatccga cgcgccggca tctcacgccg       960
     aaggtgcggc tttttatcga tgagttgatc gaagcgtggc agccggtgcc gccgtgggaa      1020
     gaagcggacg cctga                                                       1035
//

If you have problems or comments...

PBIL Back to PBIL home page