(data stored in ACNUC7421 zone)

EMBL: CP001053.PE11

CP001053.PE11        Location/Qualifiers
FT   CDS_pept        12320..13693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4000"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   bxe:Bxe_B0473 ABC efflux pump, membrane fusion protein,
FT                   HlyD subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4000"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18386"
FT                   /db_xref="GOA:B2TE65"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE65"
FT                   /protein_id="ACD18386.1"
FT                   /translation="MKRDSHPRPLSEALEDHSVEGIAILMAEPVRLARALIWAMVALVV
FT                   VGLLWSFVGRADVIVSAQGTLSPESEVRRIYAPIDGELADLYIAEGQPVQKGDVLARLN
FT                   ARGAIEAASNALQAQLKLEDAERDWKQFPEKKALMERKAAALKTQMEVEARQHENRVSE
FT                   GTTKLAEGQKAELDEARSILDNARRTREAARQELDRYSRLFAQPGGGGIAELQVEQKRT
FT                   AAMEADNAYRVAQSKLAELDFRLSHEYTQANAQLETSGQQTTDLQLQYDSAVRDITDAE
FT                   DKLRLQLQSARLVSEAAARIRFENIDKDNFLLILAPVSGVITDVTSTQRGDKIQANAPL
FT                   GGIAPKDARPVLKIEIAEHDRAFLHEGLPVKLKFNAFPYQRYGLISGTLAYISPATKPS
FT                   LTDKQPVYEGRVTLDKNYYQIADTRYPLRYGMTASAEIVVRERRLIDLGLDPFRQVAG"
     gtgaaacgcg acagtcaccc taggccgttg tcggaggcac tggaagatca cagcgtcgag        60
     ggcatcgcga tcctgatggc ggagccggtg cggctcgcgc gcgcgctgat ctgggcgatg       120
     gtcgcactgg tcgtggtcgg gctgttgtgg tcgttcgtgg ggcgtgccga cgtgatcgtc       180
     agcgcgcagg gcaccttgtc gccggagtcc gaggtgcgcc ggatctatgc accgatcgac       240
     ggcgaactcg ccgatctgta tatcgccgaa gggcaaccgg tgcagaaagg cgatgtgctg       300
     gcgcgcctga atgcgcgcgg cgcgatcgag gccgctagca acgcgttgca agcgcagctc       360
     aaactggaag acgccgagcg cgactggaag cagtttcccg agaagaaagc gctcatggag       420
     cgaaaggccg cagcgctcaa gacgcagatg gaagtggaag cgcgccagca cgaaaatcgc       480
     gtctccgaag gcacgaccaa actcgcggaa gggcagaagg ccgaactcga cgaagcgcgc       540
     agtatcctcg acaacgcccg gcgcacgcgc gaagcggcgc gtcaggaact ggaccgctac       600
     tcgcggctct tcgcgcagcc gggtggcggt ggcatcgccg aattgcaggt ggagcaaaaa       660
     cgcacggcgg caatggaggc ggataacgct taccgtgtcg cccaatcgaa actcgcggaa       720
     ctggatttcc gcttgagcca cgaatatacg caggcgaatg cgcaactgga aaccagcggc       780
     cagcagacta cagacctgca gcttcaatac gattcggcgg tgcgcgacat taccgacgcg       840
     gaagacaagt tgcgcctgca actgcaaagt gcgcgcttgg tgtctgaagc ggctgcgcgg       900
     attcgcttcg agaacatcga caaagataat ttcctgctga ttctcgcgcc ggtttcgggc       960
     gtcatcaccg acgtgacgtc aactcagcgc ggcgacaaga ttcaggcaaa cgcgccgctc      1020
     ggcggcattg cgcccaaaga cgcgcggccc gtgctgaaga ttgaaatcgc cgaacacgat      1080
     cgtgcgtttc tgcacgaggg tctgccggtc aaactgaaat tcaacgcttt tccgtatcaa      1140
     cgctatgggc tgatcagcgg cacgctggcc tatatttcac cggccactaa accgtcgttg      1200
     acggacaagc agccggtcta cgaaggccgc gtcacgctcg acaaaaatta ctaccagatt      1260
     gccgacacgc gttatccgtt gcgctacggc atgacggcaa gcgctgagat cgtggtgcgc      1320
     gagcggcgcc tgatcgatct gggtctcgat ccgttcaggc aggtggcggg ttga            1374
//

If you have problems or comments...

PBIL Back to PBIL home page