(data stored in ACNUC7421 zone)

EMBL: CP001053.PE116

CP001053.PE116       Location/Qualifiers
FT   CDS_pept        complement(147155..148531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4107"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: rha:RHA1_ro08874
FT                   probable metabolite transporter, MFS superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4107"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18491"
FT                   /db_xref="GOA:B2TEH0"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEH0"
FT                   /protein_id="ACD18491.1"
FT                   /translation="MIQDTQQGTHAAMRTRAVTAAAVGTALEWFDFTLYGALAATVLPK
FT                   LFFPSMDSTSALLASLATFGVGLAARPLGAIICGHLGDKLGRRNLMLGTVTVMGLASML
FT                   MGLLPTYASIGVWAPVLLVLLRILQGFALGGESTGAQLMAIEHASADRRGKYSGLLGLC
FT                   SPLSQIMANGVLLLLSSMMSAQAFDSYGWRIPFILSFILVVVGVYIRLRVSETPAFVAL
FT                   RKTEVVHVGSPLRDALRLHWRTVLRWMLFFCGPAAIFYLIVVFSLSYITKTLAIPKQTG
FT                   FLLLMGANVCAIVGALAGGMLSDKIGRKKALAIGSIATLLMLFVYFQILDTKSFVPMLA
FT                   AMGFFLGFTQFQSGIQPVAFAEAFPTNVRYSGSALAYTGANLVAGGPMPVLAVWLFSVC
FT                   NGSPWGVVAVCVVFNVISLVMILTARETLGIDMNRTDSTAAVTGEADFTPAHVSNSHRT
FT                   "
     atgattcagg acacacaaca aggcacgcat gccgcgatgc gcacccgagc ggtgacggcg        60
     gcggccgtcg gcaccgcgct cgagtggttc gacttcacgc tttacggtgc attggccgcc       120
     acggttttgc ccaagctgtt tttcccgtcg atggattcga cctccgccct gctcgcctcg       180
     ctcgcgacct tcggcgtggg gctcgcggcg cggccgctcg gcgcgatcat ctgcggccat       240
     ttgggcgaca agctcgggcg gcgcaacctc atgctcggca ccgtcacggt gatgggcctc       300
     gcctcgatgc tgatgggcct gctgccgacc tacgcgagca tcggcgtatg ggcgccggtc       360
     ctgctggtgc tgctgcgcat tctgcaaggc ttcgcgctgg gcggcgagtc gaccggcgcg       420
     cagttgatgg caatcgaaca cgccagcgcc gaccggcgcg gcaagtactc cgggctgctg       480
     ggcctgtgtt cgccgctgag tcagatcatg gccaacggcg tgttgcttct gctgtcgtcc       540
     atgatgtcgg cgcaggcatt cgattcgtac ggttggcgca ttcctttcat actgagcttc       600
     atcctggtgg tggtcggcgt gtatatccgc ttgcgagtca gcgagacgcc cgctttcgtc       660
     gcgctgcgta aaacggaagt cgtacacgtg ggcagcccgc tgcgcgatgc attgcgcctg       720
     cactggagaa ccgtgctgcg ctggatgctg ttcttctgcg gacccgcggc gatcttctac       780
     ctgatcgtgg tgttctcgct cagctacatc acgaagacgc tcgctatccc gaagcaaacc       840
     ggctttctgt tgctaatggg cgccaatgtc tgcgcgatcg tcggcgcgct tgccggcggc       900
     atgctgagcg ataagatcgg ccgcaagaag gcgctcgcga tcggttcgat cgcaaccttg       960
     ctgatgctgt ttgtgtactt ccagattctc gacaccaaga gctttgtacc gatgctcgcg      1020
     gcgatgggct tcttcctcgg cttcacgcag tttcaaagcg gcattcagcc ggtcgcgttc      1080
     gccgaagcgt ttccgaccaa tgtgcgctac tccggctccg cgctcgccta taccggcgcg      1140
     aacctggtgg cgggcggccc gatgccggtg ctggcggtat ggcttttctc cgtgtgcaac      1200
     ggctcgcctt ggggtgtggt cgccgtgtgc gtggtcttca acgtgatttc gctcgtgatg      1260
     atcctgacgg cgcgcgaaac cctcggcatc gacatgaacc gcaccgactc gacggcggcc      1320
     gtcacgggcg aagcggactt tacgccggcg cacgtgagca acagccaccg cacgtaa         1377
//

If you have problems or comments...

PBIL Back to PBIL home page