(data stored in ACNUC7421 zone)

EMBL: CP001053.PE117

CP001053.PE117       Location/Qualifiers
FT   CDS_pept        148770..149552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4108"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; KEGG: pna:Pnap_2705 regulatory proteins,
FT                   IclR"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4108"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18492"
FT                   /db_xref="GOA:B2TEH1"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEH1"
FT                   /protein_id="ACD18492.1"
FT                   /translation="MPGVTERTLAVLEFLAAQMEGTPLAMIADELEIPRSACHRLLVDL
FT                   KQCGYVRQLREHGDYVLTTKLVGLGLGFLATSGIVDIAQTMLDRLAETSGELVRLAIVD
FT                   GDRLTWVAKAQGALKGLRYDPDMGMDTILSCSATGHAWMMTMTDERALELVTRQGFGQP
FT                   KQYGPNAPTTISGLLKFVHAARERGYATINEVFAPGMTAMAAPVQRRGYPAMGVISIAG
FT                   PLVRLDEKRMASLGSTLLAAASELAAASHASPLFNRGR"
     atgccaggcg ttaccgaacg caccctcgcg gtactcgaat ttctcgccgc gcagatggag        60
     ggcacgccgc tcgcgatgat cgcggacgag ctcgagattc cgcgcagcgc gtgccatcgg       120
     ctgctcgtcg atctgaagca atgcggttat gtgcggcagt tgcgcgagca tggcgattac       180
     gtgctcacca ccaagctcgt tgggttgggg ctcggttttc tcgcgacgtc cggcatcgtt       240
     gacatcgcgc agacgatgct cgaccggctc gccgaaacat ccggcgagct ggtgcggctg       300
     gcaatcgtgg acggcgaccg gctgacgtgg gtcgccaagg cgcagggcgc gttgaagggt       360
     ttgcgctacg acccggacat gggcatggac acgatcctct cgtgcagcgc cacgggccac       420
     gcatggatga tgacgatgac cgacgaacgc gcgctcgaac tcgtcacgcg gcagggcttt       480
     gggcaaccga aacaatacgg accgaacgcg ccgaccacga tcagcggact gctgaagttc       540
     gtgcacgccg cgcgcgaacg aggctacgcg acgatcaacg aagtctttgc ccccggcatg       600
     acggcaatgg ccgcgcccgt gcagcggcgc ggctatcccg cgatgggggt gatcagtatt       660
     gccgggccgc tcgtgcggct cgacgaaaaa cgcatggcca gcctcggttc gacactgctt       720
     gcggcggcct cggaacttgc cgccgcgagc cacgcgtcac cgctgttcaa tcgaggccgc       780
     tag                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page