(data stored in ACNUC7421 zone)

EMBL: CP001053.PE119

CP001053.PE119       Location/Qualifiers
FT   CDS_pept        complement(150684..151547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4110"
FT                   /product="Hydroxyquinol 1,2-dioxygenase"
FT                   /EC_number="1.13.11.37"
FT                   /note="PFAM: intradiol ring-cleavage dioxygenase; Catechol
FT                   dioxygenase domain protein; KEGG: bam:Bamb_3333 catechol
FT                   1,2-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4110"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18494"
FT                   /db_xref="GOA:B2TEH3"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR007535"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="InterPro:IPR039390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEH3"
FT                   /protein_id="ACD18494.1"
FT                   /translation="MRNLDENTITEAVLARHAHSGDERLKTIVTSLVRHLHDFAREVNL
FT                   TESEWEQGIRFLTDVGLITDDKRQEFILLSDTLGLSMLVTAMANRKPPGCTEATVFGPF
FT                   FVEGAPAYRNGDDVSNGARGEPCFVSGTVKGADGEAVANARIEVWQADADGFYDVQHAG
FT                   DDTHRARGVLHSLADGRYHFRSIVAEPYPIPHDGPVGRMLAALGRHPWRPAHLHFMITA
FT                   PGYERLVTHVFREGDQYLDSDAVFGVRSSLVAQWKHHEAGTAPDGTSMTTPFSTLEFDF
FT                   VLNRSV"
     atgcgcaatc tcgacgaaaa cacaatcacc gaagcagttc tggcgcgtca cgcgcactca        60
     ggcgacgagc ggctgaaaac catcgtcacg agcctcgtgc ggcacctgca tgatttcgcg       120
     cgcgaagtga atctgaccga gagcgaatgg gaacagggca ttcgttttct caccgacgtc       180
     ggcctcatca ctgacgacaa gcgccaggaa ttcattctgc tctcggacac gctcggcttg       240
     tcgatgctcg tcacggctat ggcgaaccgc aagccgccgg gctgcacgga agcgacagtc       300
     ttcggaccgt ttttcgtcga aggcgcgccc gcctatcgaa atggcgacga cgtgtccaac       360
     ggcgcacgcg gcgagccctg cttcgtatcg ggaaccgtca agggagccga cggcgaagcg       420
     gtggccaatg cgcgcatcga ggtctggcaa gccgacgcgg acggcttcta cgatgtgcaa       480
     cacgccggtg acgacacgca tcgcgcgaga ggcgtgctcc atagtctcgc cgacgggcgc       540
     tatcacttcc gttccatcgt cgccgagcct tatccgattc cacacgatgg accggtcggg       600
     cgtatgctcg cggcgctcgg ccggcatccg tggcgtccgg cgcatctgca tttcatgatc       660
     acggcgccgg gctatgagcg cctcgtgacc cacgtgttcc gcgaaggcga tcagtacctc       720
     gattcggacg cggtgttcgg cgttcgctcg tcgctcgttg cacagtggaa gcaccatgag       780
     gcaggcacgg caccggacgg cacgtccatg accacgccgt tcagcacgct tgaattcgat       840
     tttgtgctga accgatccgt gtga                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page