(data stored in ACNUC7421 zone)

EMBL: CP001053.PE122

CP001053.PE122       Location/Qualifiers
FT   CDS_pept        153559..154443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4113"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: mlo:mll0238 probable
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4113"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18497"
FT                   /db_xref="GOA:B2TEH6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEH6"
FT                   /protein_id="ACD18497.1"
FT                   /translation="MDLTSLADFNAVALHGGFGPASRALDRPKATLSRRVAELEETLGV
FT                   RLIERGSRTLRLTEEGLALHERTRGLMAEIQEAGEAVASRAPVPRGRLRISAPVVFAHV
FT                   VLVRIATRFALAYPQVELEVVAEDRVVDPVEDGYDLVIRINPAPDQQLVGRRILGDELL
FT                   LVAAPTMSIPPWAAGDAAALAVPAVVSVAASANAIWSVRTESGPRSLAPMPVLRLSSLL
FT                   MVRNAVLDGVGAAMLPKLLVEQDVAAGRLVCWGVADGPPVEIWALYNSRRLLSAKVRAF
FT                   MDLLRDLPGRERQ"
     atggatttga cgtcgctggc cgatttcaat gcggttgcgc tgcacggcgg cttcggcccg        60
     gccagccggg cgctcgaccg ccccaaggcc acgctgtcgc ggcgcgtggc ggaactggaa       120
     gaaacgcttg gcgtgcggct gatcgagcgt ggctcgcgca cgttgcggct gaccgaagaa       180
     ggtctcgcac tgcacgagcg cacgcgggga ttgatggcgg agattcagga ggcaggcgag       240
     gcggtagcgt cgcgcgcgcc cgtgccgcgc gggcgattgc ggatcagtgc gccggtcgtg       300
     ttcgcgcacg tggtgctggt gcggatcgcg acacgttttg cgttggccta tccgcaggtc       360
     gagctcgaag tggtggcgga agaccgcgtt gtcgacccgg tggaagacgg ttacgacctg       420
     gtcatccgca tcaatcctgc gcctgaccag caactggtgg gccggcgcat tctcggcgac       480
     gaactgctcc tggtcgctgc acccacgatg tcgatacctc catgggccgc tggcgatgct       540
     gccgcgttgg cggtgcccgc ggtcgtgtcc gtggcggcat cggcgaatgc gatatggagc       600
     gtgcgcacgg aaagtggtcc gagatcgctc gcgccgatgc cggtgctgcg gctctcatcg       660
     ctgctgatgg tgcgcaacgc ggtgctcgat ggagtgggcg cggcgatgtt gcctaaattg       720
     ctggtcgaac aggatgtggc ggcgggacgg ctcgtttgct ggggtgtggc ggatggaccg       780
     ccggtcgaga tctgggcgct gtacaactcg cggcgcttgc tgagcgcgaa ggtccgggcg       840
     ttcatggatc tgctgcgaga cttgccggga cgcgagcgcc aatag                       885
//

If you have problems or comments...

PBIL Back to PBIL home page