(data stored in ACNUC7421 zone)

EMBL: CP001053.PE123

CP001053.PE123       Location/Qualifiers
FT   CDS_pept        complement(154499..155131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4114"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0542 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4114"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18498"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEH7"
FT                   /protein_id="ACD18498.1"
FT                   /translation="MKRSAAEIITEYGPFEGMERVHGVTYDGQHVWFATGNALNAFDPE
FT                   SGKQVRSIDVAAHAGTAFDGEHLFQIAEDRIQKIDPKTGRVLATIPAPGGGADSGLAWA
FT                   EGTLWVGQYRERKIHQVDPQTGAILRTIESNRFVTGVTWVDGELWHGTWEGDESELRRI
FT                   DPRTGEVQERLEMPAGVSVSGLESNGGDRFYCGGGSSGKVRAVRRPK"
     atgaaacgat cagccgccga aatcatcacc gagtacggac cctttgaggg catggaacgc        60
     gtgcatggcg tgacgtacga cggccagcac gtctggttcg caacgggcaa cgcgttgaac       120
     gcgttcgacc cggaaagcgg caagcaggtc cgctcgatcg atgtcgccgc gcacgccggt       180
     acggccttcg acggcgagca tctgttccag atcgccgagg accgtatcca gaagatcgat       240
     cccaagaccg gccgcgtgct tgccacgatt cccgcgccgg gcggcggtgc ggactcggga       300
     ctcgcgtggg ccgaagggac gctgtgggtc ggacagtatc gggagcgcaa gatccatcaa       360
     gtcgatccgc agacgggagc gattctgcgc accatcgagt ccaatcgctt cgtgaccggc       420
     gtcacgtggg tcgacggtga gctgtggcat ggcacgtggg aaggcgacga aagcgaattg       480
     cggcgcatcg atccgcgcac cggcgaagtt caggagcggc tggagatgcc cgcaggagtc       540
     agcgtgtcgg gacttgagtc caatggcggc gaccggttct attgcggcgg cggaagcagc       600
     ggcaaggtac gggcggtgcg acggcccaag tga                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page