(data stored in ACNUC7421 zone)

EMBL: CP001053.PE125

CP001053.PE125       Location/Qualifiers
FT   CDS_pept        156492..157259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4116"
FT                   /product="protein of unknown function DUF899 thioredoxin
FT                   family protein"
FT                   /note="PFAM: protein of unknown function DUF899 thioredoxin
FT                   family protein; KEGG: bxe:Bxe_B0544 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4116"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18500"
FT                   /db_xref="InterPro:IPR010296"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEH9"
FT                   /protein_id="ACD18500.1"
FT                   /translation="MTTKHSIGTREEWLAARLELLDAEKALTRQSDELARQRQALPWVR
FT                   IDKAYRFETDEGSASLTDLFRGRSQLLVYHFMFGPDYAAGCPSCSAVADGFNGSVVHLA
FT                   NHDVAMTAVSRAPLAKLQAYKRRMGWAFPWASSAGSDFNFDINVSFTEQQQRDGSVEYN
FT                   YQRGGHAMDTTPAPAPVVEFAAACGTDAPTYSLDRPGMSAFVLEDGAVFHTYSTYGRGV
FT                   DALWGMYQWLDRAPKGRNETGVWWRRHDEYEKH"
     atgacgacga aacacagcat cggcacacgg gaagaatggt tggccgcacg gctcgaactg        60
     ctcgacgcgg aaaaggcgct cacgcggcag agcgacgaac tggcccgcca gcggcaagcg       120
     ctgccctggg tacgaatcga caaggcatac cggttcgaga ccgatgaagg cagcgcctcg       180
     ctcaccgatc tctttcgcgg acgctcgcag ttgctcgtct atcacttcat gttcggcccc       240
     gactacgccg ccggttgtcc gtcgtgttcg gcggtcgcgg acgggttcaa cggttccgtg       300
     gtccatctgg cgaatcacga cgtcgcaatg acggcggtat cgcgcgcgcc gctcgcgaag       360
     ctgcaggcat acaagcggcg tatgggatgg gcatttccgt gggcgtcgtc ggcgggcagc       420
     gacttcaact tcgacatcaa cgtctcgttc accgagcagc agcagcgtga tggaagcgtc       480
     gaatacaact accagcgcgg cggccatgca atggatacga caccggcgcc ggcgcccgtg       540
     gtcgagttcg cggccgcgtg cggaaccgac gcgcccacgt attcactcga caggcccggc       600
     atgagcgcgt tcgtgctcga agacggcgcc gtattccaca cgtattccac ttacggacgc       660
     ggtgtggacg cgctctgggg catgtatcag tggctcgacc gcgcgcccaa aggacgtaac       720
     gaaacgggtg tgtggtggcg ccggcatgat gaatacgaga agcactga                    768
//

If you have problems or comments...

PBIL Back to PBIL home page