(data stored in ACNUC7421 zone)

EMBL: CP001053.PE126

CP001053.PE126       Location/Qualifiers
FT   CDS_pept        157460..159097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4117"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; Cache type 2
FT                   domain protein; KEGG: bpd:BURPS668_A2780 methyl-accepting
FT                   chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4117"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18501"
FT                   /db_xref="GOA:B2TEI0"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEI0"
FT                   /protein_id="ACD18501.1"
FT                   /translation="MVRFSFTQKLWLPLVVSLVALLAVSVSAAWLSRQTRIEERKNDLV
FT                   NVAHVGLSIVTEYAALAQSGALSEADARRQALERLRGIRYGEDGYFLVIDSTPRMVMHA
FT                   MKPALNGKDLAGTADADGRHHYVTFAAVAQKPNGGFVDYVFPHPQDPPSAAVGKIGYVV
FT                   RYAPWDWIIATGAYVDDIDAAFKESLYFVGGIFAVLALLLSALVSLTNRSIRRTIGGDP
FT                   VYVAQVAGEITRGNLAIPINLRHGDESSLLHTVYLMRDALAHTIEQIKGAADKVATGAR
FT                   EIAGGNTDLSARTENQAASLEETAASMEQMTAMVRQTAENAQTASQLTAGAEQIVNRGG
FT                   EMAAQAVSTMQEISTESHKMVEIISVIEGIAFQTNILALNAAVEAARAGDAGRGFAVVA
FT                   GEVRTLAQRSAAAAKEIRALISHAVDKVGTGAEFVGQTGATIHSAREAIAKVSGVMRDI
FT                   AAAAAEQSAGIDQVGDAVAQMDSVTQQNAALVEQAAAVAQTLTEQARLLQVSISQFNLQ
FT                   QHGADEAAGLLRVRRPAAEEARGFAAVV"
     atggtccgat tcagtttcac acagaagctc tggctgccgc tggtcgtcag tctcgtggca        60
     cttctcgccg tgtccgtgtc ggcggcgtgg ctgtcgcggc agacgcgcat cgaggagcgc       120
     aaaaacgatc tcgtgaacgt ggcgcatgtc ggactcagca tcgtgaccga atatgcggcg       180
     ctggcgcaaa gcggcgcact tagcgaagcg gacgcccgcc ggcaggcgct tgaacggctg       240
     cgcggcatac gttacggcga ggacggctat tttctcgtca tcgattcgac accgcgcatg       300
     gtcatgcatg caatgaagcc tgcgctgaac ggcaaggatc tcgccggcac tgcagatgcc       360
     gacggccgcc accactacgt gacgttcgcc gcggtcgcgc agaagccgaa cggcggcttc       420
     gtcgattatg ttttcccgca tccgcaggac ccgccctcgg ccgcggtcgg caagatcggc       480
     tacgtggtgc gttacgcgcc gtgggactgg atcatcgcca cgggcgctta cgtggatgac       540
     atcgacgccg cgttcaagga gtctctgtat ttcgtcggcg gaatctttgc ggtcttggcg       600
     ctgctgctgt ccgcgctcgt ctcgctgacc aatcgcagca tccggcgcac gatcggcggc       660
     gatccggtct acgtcgcgca agtggccggc gaaattaccc ggggcaacct tgccattccc       720
     atcaacctcc gtcacggcga cgagtcgagc ctgctgcaca ccgtgtacct tatgcgcgac       780
     gcgctcgctc acacgatcga acagatcaaa ggcgcggccg acaaggtggc gaccggcgcg       840
     cgtgagattg ccggcggcaa cacggatctg tcggcgcgca cggaaaatca ggcggcatcg       900
     ctcgaagaaa ccgcggcgag catggagcaa atgacggcga tggtccgaca aacggcggag       960
     aacgcgcaga cagcgagcca gctgaccgcc ggcgcggagc agatcgtcaa tcgcggcggc      1020
     gagatggcgg cacaagcggt atcgacgatg caggagatat cgacggaatc gcacaagatg      1080
     gtggagatca tctcggtcat cgaaggcatc gcgtttcaga ccaatattct ggcgctgaac      1140
     gcggcggtcg aagcggcccg ggccggcgac gcggggcgtg gtttcgcggt ggtcgccggc      1200
     gaggttcgca cgctcgcgca gcgtagcgcg gcggcagcga aggaaatccg cgcgctgatc      1260
     agccacgcgg tggacaaggt cgggaccggc gccgagttcg tcgggcaaac cggcgcgacg      1320
     attcactccg cgcgcgaggc cattgcgaaa gtctcgggtg tcatgcgcga tatcgcggcg      1380
     gcggccgccg agcaaagcgc cggcatcgat caggtcggcg acgccgtcgc gcagatggat      1440
     agcgtaacgc agcaaaacgc ggcgctggtc gagcaggccg cggcggtggc gcagacgctc      1500
     accgaacagg cgaggctgct gcaggtgtcg atcagccagt tcaacttgca gcagcatggc      1560
     gccgacgaag cggctgggct gttgcgagtc cgtaggccgg cagcggaaga agcgcgcgga      1620
     tttgcagccg tcgtttga                                                    1638
//

If you have problems or comments...

PBIL Back to PBIL home page