(data stored in ACNUC7421 zone)

EMBL: CP001053.PE131

CP001053.PE131       Location/Qualifiers
FT   CDS_pept        complement(164104..164850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4122"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: bxe:Bxe_B0549 putative short-chain
FT                   type dehydrogenase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4122"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18506"
FT                   /db_xref="GOA:B2TEI5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEI5"
FT                   /protein_id="ACD18506.1"
FT                   /translation="MNDLTGKTALVTGASRGIGRASALALARAGAQVLVHYSSGEKEAD
FT                   AVVAEIRAAGGNAQKVAANLRAADGPHTLAKQVRAVIGHRLDILVANAGISKGVSIEDT
FT                   TVEDFDDLFAVNVRAPYFLVQQLLPVMCKGSSVVLLSSLAARAAVGTLSAYAATKGAVD
FT                   TLVKHFAAALGERGIRVNAVAPGVVETDMSNFTKTDTGRAATLGMQALKRVAQPDDIGG
FT                   AVAFLASDAARWVTGETLHVDGGSKL"
     atgaacgacc tcacaggaaa aaccgcgctc gtcacgggcg cttcacgcgg catcggccgc        60
     gccagtgctc tggcgctcgc cagggccggc gcgcaggtgc tggttcacta cagcagcggc       120
     gaaaaagagg cagatgccgt ggttgcggaa attcgcgcgg ccggcggcaa tgcgcagaaa       180
     gtcgccgcga atctgcgcgc ggcggacggc ccgcatacgc tcgccaaaca ggtgcgcgcc       240
     gtgatcggcc atcggctgga tattctggtg gcgaacgccg ggatttcgaa gggcgtcagc       300
     atcgaggaca cgaccgtcga agacttcgac gatctgttcg ccgtgaacgt gcgcgcgcct       360
     tacttcctcg tgcagcaatt gctgccggtg atgtgcaagg gcagcagcgt ggtgctgctg       420
     tcgtcgctcg cggcgcgcgc cgcggtcggc acgctgtcgg cctacgccgc caccaagggc       480
     gcggtcgata cgctcgtcaa gcatttcgct gccgcgctcg gcgaacgtgg gattcgtgtg       540
     aatgcggtcg cgccgggtgt ggtcgaaacc gatatgtcga acttcaccaa gaccgacacg       600
     gggcgcgcgg cgacgctggg tatgcaggcg ctcaagcgcg tggcgcagcc ggacgatatc       660
     ggcggcgccg tcgcctttct cgcctcggat gccgcacggt gggttaccgg cgaaacgttg       720
     catgtcgacg gcggttcgaa gctttaa                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page