(data stored in ACNUC7421 zone)

EMBL: CP001053.PE133

CP001053.PE133       Location/Qualifiers
FT   CDS_pept        166009..166908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4124"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bxe:Bxe_B0551 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4124"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18508"
FT                   /db_xref="GOA:B2TEI7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEI7"
FT                   /protein_id="ACD18508.1"
FT                   /translation="MELRHLRYFVAVAETGSLTVAAERRLHTSQPSLSRQIRDLEDEVG
FT                   AELFSRSARGVELTAAGKAFLDHARLALSQVDAAIEAARRAARPSKQVFALGFLTGQEM
FT                   TWLPRAMQVLRDELPNIDVTVSSHYSPDLADALARGKLDLAFLRAEPGFDLDYRVVSSE
FT                   KLIVLMPSDHRLTERSAIRPEDFAGETFIMASNKARVLHAVIQRYLDENGITVAPGHDV
FT                   DNLAMAMSLVASTRGLALMPEYATNLLPWSVVSRPLEGETPTVDLVIGYSRSNTSPVLK
FT                   LFLSRADELMAHVSAEPR"
     atggagcttc gacatctgcg gtacttcgtg gccgtcgccg aaacgggcag cctgacggtg        60
     gcggcggaac ggcgtctgca cacgtcgcag ccgtcgctga gccgccagat tcgcgatctg       120
     gaagacgagg tcggcgcgga gttgttcagc cgcagcgcgc gcggcgtcga gttgaccgcg       180
     gcgggcaaag ccttcctcga ccacgcgcgg ctcgcgctct cgcaagtcga cgccgctatc       240
     gaagccgcgc gccgggcggc gcggccctcc aagcaggttt tcgcgctggg atttctgacc       300
     ggccaggaaa tgacgtggct gccgcgcgcc atgcaggtgt tgcgcgatga actgccgaat       360
     atcgacgtca cggtgtcgag ccactattcg ccggacctcg cggacgcact cgcgcgcggc       420
     aagctcgacc ttgcgttttt gcgtgccgag ccgggcttcg atctggacta tcgggtggtc       480
     agtagcgaga agctgatcgt gctcatgccg agcgaccatc gccttaccga gcgcagcgcg       540
     atccgtccgg aggatttcgc cggcgagacc ttcatcatgg cgtcgaacaa ggcgcgcgtg       600
     ctgcacgctg tgatccagcg ctatctggac gaaaacggca tcacggtcgc gcccgggcat       660
     gacgtcgaca acctggccat ggcgatgtcg ctggtcgcct ccacgcgcgg gctcgcgttg       720
     atgcccgagt atgcgaccaa cctgctgccg tggtcggtgg tcagccggcc gctggaaggc       780
     gagacgccga ccgtcgatct cgtgatcggc tatagcaggt cgaatacatc gccggtgctg       840
     aagctgtttc tgtcgagagc cgacgagttg atggcgcatg tcagtgccga accgcgctga       900
//

If you have problems or comments...

PBIL Back to PBIL home page